KEGG   Ovis aries (sheep): 101102732
Entry
101102732         CDS       T03117                                 

Gene name
SOS2
Definition
(RefSeq) son of sevenless homolog 2
  KO
K03099  son of sevenless
Organism
oas  Ovis aries (sheep)
Pathway
oas01521  EGFR tyrosine kinase inhibitor resistance
oas01522  Endocrine resistance
oas04010  MAPK signaling pathway
oas04012  ErbB signaling pathway
oas04014  Ras signaling pathway
oas04062  Chemokine signaling pathway
oas04068  FoxO signaling pathway
oas04072  Phospholipase D signaling pathway
oas04150  mTOR signaling pathway
oas04151  PI3K-Akt signaling pathway
oas04510  Focal adhesion
oas04540  Gap junction
oas04630  JAK-STAT signaling pathway
oas04650  Natural killer cell mediated cytotoxicity
oas04660  T cell receptor signaling pathway
oas04662  B cell receptor signaling pathway
oas04664  Fc epsilon RI signaling pathway
oas04714  Thermogenesis
oas04722  Neurotrophin signaling pathway
oas04810  Regulation of actin cytoskeleton
oas04910  Insulin signaling pathway
oas04912  GnRH signaling pathway
oas04915  Estrogen signaling pathway
oas04917  Prolactin signaling pathway
oas04926  Relaxin signaling pathway
oas04935  Growth hormone synthesis, secretion and action
oas05034  Alcoholism
oas05160  Hepatitis C
oas05161  Hepatitis B
oas05163  Human cytomegalovirus infection
oas05165  Human papillomavirus infection
oas05200  Pathways in cancer
oas05205  Proteoglycans in cancer
oas05206  MicroRNAs in cancer
oas05210  Colorectal cancer
oas05211  Renal cell carcinoma
oas05213  Endometrial cancer
oas05214  Glioma
oas05215  Prostate cancer
oas05220  Chronic myeloid leukemia
oas05221  Acute myeloid leukemia
oas05223  Non-small cell lung cancer
oas05224  Breast cancer
oas05225  Hepatocellular carcinoma
oas05226  Gastric cancer
oas05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:oas00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101102732 (SOS2)
   04012 ErbB signaling pathway
    101102732 (SOS2)
   04014 Ras signaling pathway
    101102732 (SOS2)
   04630 JAK-STAT signaling pathway
    101102732 (SOS2)
   04068 FoxO signaling pathway
    101102732 (SOS2)
   04072 Phospholipase D signaling pathway
    101102732 (SOS2)
   04151 PI3K-Akt signaling pathway
    101102732 (SOS2)
   04150 mTOR signaling pathway
    101102732 (SOS2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101102732 (SOS2)
   04540 Gap junction
    101102732 (SOS2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101102732 (SOS2)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    101102732 (SOS2)
   04660 T cell receptor signaling pathway
    101102732 (SOS2)
   04662 B cell receptor signaling pathway
    101102732 (SOS2)
   04664 Fc epsilon RI signaling pathway
    101102732 (SOS2)
   04062 Chemokine signaling pathway
    101102732 (SOS2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101102732 (SOS2)
   04912 GnRH signaling pathway
    101102732 (SOS2)
   04915 Estrogen signaling pathway
    101102732 (SOS2)
   04917 Prolactin signaling pathway
    101102732 (SOS2)
   04926 Relaxin signaling pathway
    101102732 (SOS2)
   04935 Growth hormone synthesis, secretion and action
    101102732 (SOS2)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    101102732 (SOS2)
  09159 Environmental adaptation
   04714 Thermogenesis
    101102732 (SOS2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101102732 (SOS2)
   05206 MicroRNAs in cancer
    101102732 (SOS2)
   05205 Proteoglycans in cancer
    101102732 (SOS2)
   05231 Choline metabolism in cancer
    101102732 (SOS2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101102732 (SOS2)
   05225 Hepatocellular carcinoma
    101102732 (SOS2)
   05226 Gastric cancer
    101102732 (SOS2)
   05214 Glioma
    101102732 (SOS2)
   05221 Acute myeloid leukemia
    101102732 (SOS2)
   05220 Chronic myeloid leukemia
    101102732 (SOS2)
   05211 Renal cell carcinoma
    101102732 (SOS2)
   05215 Prostate cancer
    101102732 (SOS2)
   05213 Endometrial cancer
    101102732 (SOS2)
   05224 Breast cancer
    101102732 (SOS2)
   05223 Non-small cell lung cancer
    101102732 (SOS2)
  09165 Substance dependence
   05034 Alcoholism
    101102732 (SOS2)
  09172 Infectious disease: viral
   05161 Hepatitis B
    101102732 (SOS2)
   05160 Hepatitis C
    101102732 (SOS2)
   05163 Human cytomegalovirus infection
    101102732 (SOS2)
   05165 Human papillomavirus infection
    101102732 (SOS2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101102732 (SOS2)
   01522 Endocrine resistance
    101102732 (SOS2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:oas04990]
    101102732 (SOS2)
Domain-containing proteins not elsewhere classified [BR:oas04990]
 Pleckstrin homology (PH) domain-containing proteins
  Dbl-Like RhoGEF family proteins
   101102732 (SOS2)
SSDB
Motif
Pfam: RasGEF RasGEF_N RhoGEF Histone PH PH_19 IQ_SEC7_PH
Other DBs
NCBI-GeneID: 101102732
NCBI-ProteinID: XP_004010557
Ensembl: ENSOARG00000020627
UniProt: A0A6P3E657
LinkDB
Position
7
AA seq 1332 aa
MQQAPQPYEFYSEENSPKWRGLLVSALRKVQEQVHPNLSANEESLYYIEELIFQLLNKLC
MAQPRTVQDVEERVQKTFPHPIDKWAIADAQSAIEKRKRRNPLLLPVDKIHPSLKEVLGY
KVDYHVSLYIVAVLEYISADILKLAGNYVFNIRHYEISQQDIKVSMCADKVLMDMFDQDD
IGLVSLCEDEPSSSGELNYYDLVRTEIAEERQYLRELNMIIKVFREAFLSDRKLFKPSDI
EKIFSNILDIHELTVKLLGLIEDTVEMTDESSPHPLAGSCFEDLAEEQAFDPYETLSQDI
LSPKFNEHFSKLMARPAVALHFQSIADGFKEAVRYVLPRLMLVPVYHCWHYFELLKQLKI
CSEEHEDRECLNQAITALMNLQGSMDRIYKQFSPRRRPGDPVCPFYNRQLRSKHLAIKKM
NEIQKNIDGWEGKDIGQCCNEFIMEGPLTRIGAKHERHIFLFDGLMISCKPNHSQSRLPG
CSSAEYRLKEKFVMRKIQICDKEDTCECRHAFELVSKDENSIIYAAKSAEEKNNWMAALI
SLQYRSTLDRMLDSVLLKEENEQPLRLPSPEVYRFVVKDSEENIVFEDNLQSRSGIPIIK
GGTVVKLIERLTYHMYADPNFVRTFLTTYRSFCKPQELLSLLTERFEIPEPEPTEADKLA
LEKGEQPISTDLKRFRKEYVQPVQLRVLNVFRHWVEHHFYDFERDLELLERLEFFISSVR
GKAMKKWVESIAKIIKRKKQAQANGISHNITFESPPPPIEWHISRPGQFETFDLMTLHPI
EIARQLTLLESDLYRKVQPSELVGSVWTKEDKEINSPNLLKMIRHTTNLTLWFEKCIVEA
ENFEERVAILSRIIEILQVFQDLNNFNGVLEIVSAVNSVSVYRLDHTFEALQERKRKILD
EAVELSQDHFKKYLVKLKSINPPCVPFFGIYLTNILKTEEGNNDFLKKKGKDLINFSKRR
KVAEITGEIQQYQNQPYCLRIEPEMRRFFENLNPMGCASEKEFTDYLFNKSLEIEPRNCK
QPPRFPRKSAFSLKSPGIRPNTGRHGSTSGTLRGHPTPLEREPCKISFSRIAETELESTV
SAPTSPNTPSTPPVSASSDLSVFLDVDLNSSCGSNSIFAPVLLPHSKSFFSSCGSLHKLS
EEPLIPPPLPPRKKFDQDASNSKGTMKSDDDPPAIPPRQPPPPKVKPRVPAPTGPFDGPL
HSPPPPPPRDPLPDTPPPVPLRPPEHFINCPFTLQPPPLGHLHRDPDWFRDVNTCPNSPN
TPPSTPSPRVPRRCYVLSSSQNNLAHPQAPPVPPRQNSSPHLPKLPPKTYKRELSHPPMY
RLPLLENAETPQ
NT seq 3999 nt   +upstreamnt  +downstreamnt
atgcagcaggcgccgcagccttacgagttctacagcgaagagaacagtccgaaatggcgg
ggactgttggtctcggccctgcggaaggttcaggagcaagtacatcccaatctctcagct
aatgaagagtctctctattatattgaagagctgatttttcagctgcttaataaattatgc
atggcccaaccaaggactgttcaagatgtggaggaacgagttcaaaagacctttcctcat
ccaattgataaatgggctattgctgatgcacagtctgccatagagaaacgaaaaagaaga
aatcctctcttactgcctgtggacaaaatccatccttcattgaaggaagttttagggtac
aaagtggactaccatgtatccctgtatattgtggctgtgctagagtatatctcagctgat
attttgaaattggctggtaattatgtttttaatatccgacattatgaaatatctcaacaa
gacattaaagtgtcaatgtgtgcagataaggttttgatggacatgtttgatcaggatgac
ataggcttggtttctctttgtgaagatgaacctagttcttcaggcgaattaaactactat
gaccttgttagaactgaaattgcagaagaaagacagtatctacgggaactaaatatgatc
ataaaagtgtttcgagaagcttttctttctgacagaaagctgtttaaaccttctgatatt
gaaaagattttcagtaacattttagatatacatgagctgactgtgaaacttttaggttta
attgaagacacagttgaaatgactgatgaaagtagccctcatcccttagctggcagctgt
tttgaagatctggcagaggagcaagcatttgatccttatgaaacattatcccaggatatt
ctttcaccgaagtttaatgaacattttagtaagttgatggccagacctgcagtggctcta
cactttcagtccattgctgatggttttaaagaggcagttcgttacgtccttccacgcctt
atgctggtgccagtatatcattgttggcactattttgaattattaaagcaattgaaaata
tgtagtgaagagcatgaagacagagaatgtttgaaccaagctattactgctctcatgaat
ctccaaggtagtatggaccgaatttacaagcagttttcacctagacgccgacctggggat
cctgtttgccctttttataatcgtcaattaagaagcaagcacctggctattaaaaaaatg
aatgaaattcagaaaaacatagatggatgggaaggcaaagacattggacagtgttgtaat
gaatttattatggaaggcccattgacaagaattggtgctaaacatgaacggcatattttt
ctctttgacggcttaatgatcagctgcaaacccaaccacagccagtcacgcctcccagga
tgcagcagtgcagagtacagactaaaagagaaatttgtcatgaggaagatacagatatgc
gataaagaagatacgtgtgagtgcaggcacgcctttgagttagtatccaaagatgaaaac
agcataatatatgctgctaagtctgctgaagagaaaaataactggatggcagcacttatt
tcccttcagtaccgtagtactctggatcgaatgctggattcggtattattgaaggaagaa
aatgagcaaccattgagattaccaagtcctgaagtgtatcgttttgtggtgaaagactct
gaggaaaacattgtttttgaagacaacttgcagagtagaagtggaatccccattattaaa
ggaggaactgtggtgaaattaattgaaaggctaacatatcatatgtacgcagatcccaat
tttgttcgtacctttcttactacgtaccgttcattttgtaaaccacaggaattactaagc
ttactgactgaacgatttgaaattccagagccagaacctactgaagcagataaattggca
ttagaaaaaggcgagcagcccatcagtacagacctaaaaaggtttcgcaaggaatacgtc
caaccagtacaacttagggtcttgaatgtgtttcggcactgggttgaacaccatttttat
gactttgaaagagacttggagctgcttgaaagactagaattcttcatttcaagtgtaaga
gggaaagctatgaagaaatgggtagagtcaattgctaagatcatcaagaggaaaaaacaa
gctcaggcaaatggtataagccataatattacctttgaaagtccacctccaccaattgaa
tggcatatcagcagaccaggacagtttgaaacatttgatctcatgacacttcatccaata
gaaattgcacgtcagctgacccttttggaatctgatctctacaggaaagttcaaccttct
gaacttgtagggagtgtatggaccaaagaagataaagaaataaactctccaaatttatta
aaaatgattcgccacaccacaaatctcaccctctggtttgaaaaatgcattgtggaggca
gaaaattttgaggaacgggtggcaatactgagtagaattatagaaattctgcaagttttt
caagatttgaataatttcaatggtgtattggagatcgtcagtgcagtaaattcagtatca
gtctatagactagatcatacctttgaggcgttgcaggaaagaaaaaggaaaattttggat
gaagctgtggaattaagtcaagatcattttaaaaaatatctagtgaaacttaagtcaatc
aatccaccctgtgtgcctttttttggaatatatttaacaaatatactgaagactgaagaa
gggaataatgattttttaaaaaagaaagggaaagatttaatcaatttcagtaagaggagg
aaagtagctgaaattactggagaaattcagcagtatcaaaatcaaccttactgtttacgg
atagaaccagaaatgaggagattctttgaaaaccttaaccccatgggatgtgcttctgaa
aaagagtttacagattatttgttcaacaagtcactagaaattgaaccccgaaactgcaaa
cagccacctcgatttcctaggaaatcagctttctccttaaaatctcctggaataaggcct
aatacaggccgacatggctctacctcaggtactttgcgaggtcacccaacaccattagaa
agagaaccgtgtaaaataagctttagtcgcattgctgaaacggagcttgaatcaacagtg
tcagcaccaacctctccaaatacaccatctaccccaccagtatctgcttcttcagacctt
agtgtgtttttagatgtggatctcaacagttcctgtggaagcaatagcatctttgctcca
gtcctcttgcctcattcaaagtctttcttcagttcgtgtggtagtttacataagctaagt
gaagagccactgattcctcctccacttccacctcgaaaaaaatttgatcaggatgcttca
aattccaagggaactatgaaatctgatgatgacccccctgctattccaccaagacaacct
cctcctccaaaggtaaaacccagagttcctgctcctactggtccatttgatgggcctctg
catagtccacctccaccaccgccgagagatcctcttcctgatacccctccaccggttcca
cttcggcctccagaacactttataaactgtccgtttactcttcagccacctccactggga
catcttcacagagatccagactggttcagagacgttaatacgtgtccaaattctccaaac
actcctcctagcacaccctctccaagggtacctcgtcgatgctatgtgctcagttctagt
caaaataatcttgctcatcctcaagctccccctgttccaccaaggcagaattcaagccct
catctaccaaaactgccaccaaagacttacaaacgggagctttcacaccccccaatgtat
agactgccattgttagaaaatgcagaaactcctcaatga

KEGG   Ovis aries (sheep): 101118865
Entry
101118865         CDS       T03117                                 

Gene name
SOS1
Definition
(RefSeq) son of sevenless homolog 1 isoform X1
  KO
K03099  son of sevenless
Organism
oas  Ovis aries (sheep)
Pathway
oas01521  EGFR tyrosine kinase inhibitor resistance
oas01522  Endocrine resistance
oas04010  MAPK signaling pathway
oas04012  ErbB signaling pathway
oas04014  Ras signaling pathway
oas04062  Chemokine signaling pathway
oas04068  FoxO signaling pathway
oas04072  Phospholipase D signaling pathway
oas04150  mTOR signaling pathway
oas04151  PI3K-Akt signaling pathway
oas04510  Focal adhesion
oas04540  Gap junction
oas04630  JAK-STAT signaling pathway
oas04650  Natural killer cell mediated cytotoxicity
oas04660  T cell receptor signaling pathway
oas04662  B cell receptor signaling pathway
oas04664  Fc epsilon RI signaling pathway
oas04714  Thermogenesis
oas04722  Neurotrophin signaling pathway
oas04810  Regulation of actin cytoskeleton
oas04910  Insulin signaling pathway
oas04912  GnRH signaling pathway
oas04915  Estrogen signaling pathway
oas04917  Prolactin signaling pathway
oas04926  Relaxin signaling pathway
oas04935  Growth hormone synthesis, secretion and action
oas05034  Alcoholism
oas05160  Hepatitis C
oas05161  Hepatitis B
oas05163  Human cytomegalovirus infection
oas05165  Human papillomavirus infection
oas05200  Pathways in cancer
oas05205  Proteoglycans in cancer
oas05206  MicroRNAs in cancer
oas05210  Colorectal cancer
oas05211  Renal cell carcinoma
oas05213  Endometrial cancer
oas05214  Glioma
oas05215  Prostate cancer
oas05220  Chronic myeloid leukemia
oas05221  Acute myeloid leukemia
oas05223  Non-small cell lung cancer
oas05224  Breast cancer
oas05225  Hepatocellular carcinoma
oas05226  Gastric cancer
oas05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:oas00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101118865 (SOS1)
   04012 ErbB signaling pathway
    101118865 (SOS1)
   04014 Ras signaling pathway
    101118865 (SOS1)
   04630 JAK-STAT signaling pathway
    101118865 (SOS1)
   04068 FoxO signaling pathway
    101118865 (SOS1)
   04072 Phospholipase D signaling pathway
    101118865 (SOS1)
   04151 PI3K-Akt signaling pathway
    101118865 (SOS1)
   04150 mTOR signaling pathway
    101118865 (SOS1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101118865 (SOS1)
   04540 Gap junction
    101118865 (SOS1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101118865 (SOS1)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    101118865 (SOS1)
   04660 T cell receptor signaling pathway
    101118865 (SOS1)
   04662 B cell receptor signaling pathway
    101118865 (SOS1)
   04664 Fc epsilon RI signaling pathway
    101118865 (SOS1)
   04062 Chemokine signaling pathway
    101118865 (SOS1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101118865 (SOS1)
   04912 GnRH signaling pathway
    101118865 (SOS1)
   04915 Estrogen signaling pathway
    101118865 (SOS1)
   04917 Prolactin signaling pathway
    101118865 (SOS1)
   04926 Relaxin signaling pathway
    101118865 (SOS1)
   04935 Growth hormone synthesis, secretion and action
    101118865 (SOS1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    101118865 (SOS1)
  09159 Environmental adaptation
   04714 Thermogenesis
    101118865 (SOS1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101118865 (SOS1)
   05206 MicroRNAs in cancer
    101118865 (SOS1)
   05205 Proteoglycans in cancer
    101118865 (SOS1)
   05231 Choline metabolism in cancer
    101118865 (SOS1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101118865 (SOS1)
   05225 Hepatocellular carcinoma
    101118865 (SOS1)
   05226 Gastric cancer
    101118865 (SOS1)
   05214 Glioma
    101118865 (SOS1)
   05221 Acute myeloid leukemia
    101118865 (SOS1)
   05220 Chronic myeloid leukemia
    101118865 (SOS1)
   05211 Renal cell carcinoma
    101118865 (SOS1)
   05215 Prostate cancer
    101118865 (SOS1)
   05213 Endometrial cancer
    101118865 (SOS1)
   05224 Breast cancer
    101118865 (SOS1)
   05223 Non-small cell lung cancer
    101118865 (SOS1)
  09165 Substance dependence
   05034 Alcoholism
    101118865 (SOS1)
  09172 Infectious disease: viral
   05161 Hepatitis B
    101118865 (SOS1)
   05160 Hepatitis C
    101118865 (SOS1)
   05163 Human cytomegalovirus infection
    101118865 (SOS1)
   05165 Human papillomavirus infection
    101118865 (SOS1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101118865 (SOS1)
   01522 Endocrine resistance
    101118865 (SOS1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:oas04990]
    101118865 (SOS1)
Domain-containing proteins not elsewhere classified [BR:oas04990]
 Pleckstrin homology (PH) domain-containing proteins
  Dbl-Like RhoGEF family proteins
   101118865 (SOS1)
SSDB
Motif
Pfam: RasGEF RasGEF_N RhoGEF Histone PH PH_19 PH_10 IQ_SEC7_PH PH_13
Other DBs
NCBI-GeneID: 101118865
NCBI-ProteinID: XP_014949910
Ensembl: ENSOARG00000008423
UniProt: A0A6P3YKP3
LinkDB
Position
3
AA seq 1333 aa
MQAQQLPYEFFSEENAPKWRGLLVPALKKVQGQVHPTLESSDDALQYVEELILQLLNMLC
QAQPRSASDVEERVQKSFPHPIDKWAIADAQSAIEKRKRRNPLSLPVEKIHPLLKEVLGY
KIDHQVSVYIVAVLEYISADILKLVGNYVRNIRHYEITKQDIKVAMCADKVLMDMFHQDV
EDINILSLTDEEPSTSGEQTYYDLVKAFMAEIRQYIRELNLIIKVFREPFVSNSKLFSAN
DVENIFSRIVDIHELSVKLLGHIEDTVEMTDEGSPHPLVGSCFEDLAEELAFDPYESYAR
DILRPGFHDRFLSQLSKPGAALYLQSIGEGFKEAVQYVLPRLLLAPVYHCLHYFELLKQL
EEKSEDQEDKECLKQAITALLNVQSGMEKICSKSLAKRRLSESACRFYSQQMKGKQLAIK
KMNEIQKNIDGWEGKDIGQCCNEFIMEGTLTRVGAKHERHIFLFDGLMICCKSNHGQPRL
PGASNAEYRLKEKFFMRKVQINDKDDTSEYKHAFEIILKDENSVIFSAKSAEEKNNWMAA
LISLQYRSTLERMLDVTMLQEEKEEQMRLPSADVYRFAEPDSEENIIFEENVQPKAGIPI
IKAGTVIKLIERLTYHMYADPNFVRTFLTTYRSFCKPQELLSLIIERFEIPEPEPTEADR
IAIENGDQPLSAELKRFRKEYIQPVQLRVLNVCRHWVEHHFYDFERDADLLQRMEEFIGT
VRGKAMKKWVESITKIIQRKKIARDNGPGHNITFQSSPPTVEWHISRPGHIETFDLLTLH
PIEIARQLTLLESDLYRAVQPSELVGSVWTKEDKEINSPNLLKMIRHTTNLTLWFEKCIV
ETENLEERVAVVSRIIEILQVFQELNNFNGVLEVVSAMNSSPVYRLDHTFEQIPSRQKKI
LEEAHELSEDHYKKYLAKLRSINPPCVPFFGIYLTNILKTEEGNPEVLKRHGKELINFSK
RRKVAEITGEIQQYQNQPYCLRVESDIKRFFENLNPMGNSMEKEFTDYLFNKSLEIEPRN
PKPLPRFPKKYNYPLKSPGVRPSNPRPGTMRHPTPLQQEPRKISYSRIPESETESTASAP
NSPRTPLTPPPASGASSTTDVCSVFDSDHSSPFHSSSDTVFIQVTLPHGPRSASVSSISL
TKSTDEVPVPPPVPPRRRPESAPAESSPSKMMSKHLDSPPAIPPRQPTSKAYSPRYSISD
RTSISDPPESPPLLPPREPVRTPDVFSSSPLHLQPPPLGKKSDHSNAFFPNSPSPFTPPP
PQTPSPHGTRRHLPSPPLTQEVDLHSIAGPPVPPRQSTSQHIPKLPPKTYKREHTHPSVH
RDGPPLLENAHSS
NT seq 4002 nt   +upstreamnt  +downstreamnt
atgcaggcgcagcagctgccgtacgagtttttcagcgaggagaacgcacccaagtggcgg
gggctgctggtgcctgcgctgaaaaaggttcaggggcaggttcatccaactcttgagtct
agtgatgatgctcttcagtatgttgaagaattaattttgcaactattaaatatgctatgc
caagctcaaccccgaagtgcttcagatgtagaggaacgtgttcaaaaaagtttccctcat
ccaattgataagtgggcaatagctgatgcccaatcggctattgaaaagaggaagcgaaga
aaccctttatctctcccagtagaaaaaatccatcctttgttaaaggaggtcctaggttat
aaaattgaccaccaggtttctgtttacatagtagcagtattagaatacatttccgcagac
attttgaagctggtggggaattatgtgcgaaatatacggcattatgaaattacaaaacaa
gatattaaagtggcaatgtgtgctgataaggtattgatggatatgtttcatcaagatgtg
gaagatataaatatattatctttaactgatgaagagccttccacctcaggagagcagact
tactatgatttggtaaaagcatttatggcagaaattcgacaatacataagggagcttaat
ttaattataaaagtttttagagagccctttgtctccaattcaaaattgttttcagctaat
gatgtagaaaatatatttagtcgtatagtggatatacatgaacttagtgtaaaattactg
ggccatatagaagatactgtggaaatgacagatgaaggcagtccccatccattagtagga
agctgctttgaagacttagcagaggaactggcatttgatccatatgaatcatatgctcga
gatattctgcgacctggttttcacgatcgtttccttagtcagttatcaaagcctggagca
gcactctatttgcagtcaataggcgaaggtttcaaagaagctgttcaatatgttttaccc
aggctacttctagcccctgtttaccactgtctacattacttcgaacttctgaagcagtta
gaagaaaagagtgaggatcaagaagacaaagaatgtttgaaacaagcaataacagctttg
cttaatgttcagagtggtatggaaaaaatatgttctaaaagtcttgcaaaacgaagactg
agtgaatctgcatgtcggttttatagtcagcaaatgaaggggaaacaactagcaatcaag
aaaatgaacgagattcagaagaatattgatggttgggagggaaaagacattggacagtgt
tgcaatgagtttataatggaaggaactctaacacgtgtaggagccaaacatgagagacac
atatttctctttgatggcttaatgatttgctgtaaatcaaatcatgggcagccaagacta
cctggtgctagcaatgcagaatatcgtcttaaagaaaagttttttatgagaaaggtacaa
attaatgacaaagatgacaccagtgagtacaagcatgcttttgaaataattttaaaagat
gaaaatagtgttatattttctgccaagtcagctgaagagaagaacaattggatggcagca
ctgatatctttacagtaccggagtaccctggaaagaatgctcgacgtgaccatgctgcag
gaagaaaaggaggagcagatgaggctccccagtgctgacgtgtacagatttgcagagcct
gactctgaggaaaatatcatatttgaagaaaacgtgcagcccaaagctggaattccaatt
atcaaggcaggaaccgttattaaacttatagagaggctcacataccacatgtatgcagat
cccaattttgttcggacatttcttacaacatatagatccttttgtaaacctcaagaacta
ctgagtcttataatagaaaggtttgaaattccggagcctgagccaacagaagctgatcgc
atcgctatagagaatggagaccaacccttgagtgcagaactaaaaagatttagaaaagaa
tatatacagcctgtgcagctgcgagtattaaatgtatgtcggcactgggtagagcaccac
ttctatgattttgaaagagatgcagatcttttgcagcgaatggaggaatttattggaacc
gtaagaggtaaagcaatgaaaaaatgggttgaatccatcactaaaataatccaaaggaaa
aaaattgcaagagacaatgggccaggtcataatattacatttcagagttcacctcctacg
gttgagtggcacataagcagacctgggcacatcgagacttttgacctgcttaccttacac
ccaatagaaattgctcgacaactcactttacttgaatcagatctatatcgagctgtacag
ccgtcagaattagttggaagtgtgtggacaaaagaagacaaagaaattaattctcctaat
ctcctgaaaatgatccggcataccactaatctcactctgtggtttgagaaatgtattgta
gaaactgaaaacttagaagaaagagtagctgtggtgagtcgaataattgagattctacaa
gtgttccaagagctcaacaacttcaatggtgtccttgaggttgtcagtgctatgaactca
tcccctgtttacagactagaccacacgttcgagcaaataccaagtcgccaaaagaaaatt
ttagaagaagctcatgaactaagtgaagatcactataagaaatatttggcaaaactcagg
tctattaatccaccatgtgtgcctttctttggtatttatctcactaatatcttgaaaaca
gaagaaggcaaccctgaggtcctaaaacggcatggaaaagagcttataaactttagcaaa
aggaggaaagtagcagaaataacaggcgagatccaacagtaccaaaatcagccttactgt
ttacgagtagagtcagatatcaaaaggttttttgaaaacttgaatccaatgggaaatagc
atggaaaaagaatttacggattatcttttcaacaaatccctagaaatagaaccacgaaac
cctaagcctcttccaagatttccaaaaaaatacaactatcccctaaaatctcctggtgtt
cgtccatcaaacccaagaccaggtactatgagacatcccacacctctgcagcaagagcca
aggaaaattagttatagcaggatccctgaaagtgaaacagaaagtacagcatctgcacca
aattctccaagaacaccgttaacacctcctcctgcttctggtgcttctagtaccacagat
gtttgcagcgtatttgattctgatcattcaagcccttttcactcaagcagcgataccgtc
tttatccaagttacactgccccatggcccaagatctgcttcagtatcatctataagttta
accaagagcactgatgaagtgcctgtcccccctcctgttcctccacgaagacggccagag
tctgccccagcagaatcttcaccatctaagatgatgtctaagcatttggacagcccccca
gcaattcctcctaggcaacccacgtcaaaagcctattcaccacggtattcaatatcagac
cggacctctatatcagaccctcctgagagccctcccctattacctccacgagaacccgtg
aggacacctgatgttttctcaagttcaccactacatctccaacctccccctttgggcaaa
aaaagtgaccatagtaatgccttcttcccaaacagcccctccccctttacaccacctcct
cctcaaacaccttctcctcatggaacaagaaggcatctgccgtcaccaccattgacacaa
gaagtggacctccattccattgctgggccgcctgttcctccacgacaaagcacttctcag
catatccctaaactccctccaaaaacttacaaaagggagcacacccacccgtccgtgcac
agagatggaccaccactgttggagaatgcccattcttcctga

DBGET integrated database retrieval system