KEGG   Ovis aries (sheep): 101116511Help
Entry
101116511         CDS       T03117                                 

Gene name
ALDH2
Definition
(RefSeq) aldehyde dehydrogenase, mitochondrial
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
oas  Ovis aries (sheep)
Pathway
oas00010  Glycolysis / Gluconeogenesis
oas00053  Ascorbate and aldarate metabolism
oas00071  Fatty acid degradation
oas00280  Valine, leucine and isoleucine degradation
oas00310  Lysine degradation
oas00330  Arginine and proline metabolism
oas00340  Histidine metabolism
oas00380  Tryptophan metabolism
oas00410  beta-Alanine metabolism
oas00561  Glycerolipid metabolism
oas00620  Pyruvate metabolism
oas01100  Metabolic pathways
Module
oas_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:oas00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    101116511 (ALDH2)
   00053 Ascorbate and aldarate metabolism
    101116511 (ALDH2)
   00620 Pyruvate metabolism
    101116511 (ALDH2)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    101116511 (ALDH2)
   00561 Glycerolipid metabolism
    101116511 (ALDH2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    101116511 (ALDH2)
   00310 Lysine degradation
    101116511 (ALDH2)
   00330 Arginine and proline metabolism
    101116511 (ALDH2)
   00340 Histidine metabolism
    101116511 (ALDH2)
   00380 Tryptophan metabolism
    101116511 (ALDH2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    101116511 (ALDH2)
Enzymes [BR:oas01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     101116511 (ALDH2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 101116511
NCBI-ProteinID: XP_004017458
Ensembl: ENSOARG00000010650
UniProt: W5PLV2
LinkDB All DBs
Position
17
AA seq 520 aa AA seqDB search
MLRAVALAAARLGPRQGRRLLSAATQAVPTPNQQPEVFYNQIFINNEWHDAVSKKTFPTV
NPSTGDVICHVAEGDKADVDRAVKAARAAFQLGSPWRRMDASERGRLLNRLADLIERDRT
YLAALETLDNGKPYVISYLVDLDMVLKCLRYYAGWADKYHGKTIPIDGDYFSYTRHEPVG
VCGQIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTPLTALYVANLIKEAGFPPGVVNI
IPGFGPTAGAAIASHEDVDKVAFTGSTEVGHLIQVAAGKSNLKRVTLELGGKSPNIIMSD
ADMDWAVEQAHFALFFNQGQCCCAGSRTFVQEDIYAEFVERSVARAKTRVVGNPFDSRTE
QGPQVDETQFKKVLGYIKSGKEEGAKLLCGGGAAADRGYFIQPTVFGDVQDGMTIAKEEI
FGPVMQILKFKSMEEVVGRANNSKYGLAAAVFTKDLDKANYLSQALQAGTVWVNCYDVFG
AQSPFGGYKLSGSGRELGEYGLQAYTEVKTVTVRVPQKNS
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgttgcgcgccgttgcgcttgccgcggcccgcctcggaccccgccagggccgccgcctg
ctgtccgccgccacccaggccgtgccgacccccaaccagcagcctgaggtcttctacaac
cagatctttataaacaatgagtggcatgatgccgtcagcaagaaaaccttccccacggtc
aatccatccactggggacgtcatctgtcacgtggctgaaggggacaaggcagacgtggac
agggcagtgaaggcagcccgggccgcattccagctgggctcgccctggcgccgcatggac
gcgtctgagaggggccggctactgaaccgcctggctgatctgattgagcgagaccggacc
tacctggcagccttggagaccctggacaatggcaagccctatgtcatctcctacctggtg
gatttggacatggtcctcaagtgcctgcgttactatgctggctgggctgacaagtaccac
gggaaaaccattcccatcgacggggactacttcagctacacccgccatgaacctgtggga
gtgtgtgggcagatcatcccatggaacttcccgctcttgatgcaagcctggaaactgggc
ccagccttggcaacgggaaacgtggttgtgatgaaggtggctgagcagactccactcact
gccctctatgtggccaacctgattaaggaggctggctttcctccaggtgtggtcaatatt
attcctggatttggccccacggccggagctgccatcgcctcccatgaggacgtggacaaa
gtggcattcaccggctccactgaggttggccacctaatccaggttgctgcggggaagagt
aacctgaagagagtgaccctggagctaggaggaaagagtcccaatatcatcatgtcagat
gctgatatggactgggctgtggagcaggcccacttcgccctgttcttcaaccagggccag
tgctgctgtgcaggctcgcggacctttgtgcaggaggacatttacgccgagtttgtggaa
cggagtgttgcccgggccaagactcgtgtggttgggaacccctttgacagccggactgag
caggggccgcaggtggatgaaacgcagtttaagaaggtccttggctatatcaaatctggg
aaggaggagggggcgaagctgctgtgtggtggaggggcagctgctgaccgtggctacttc
atccagcccaccgtgtttggagatgtgcaagatggcatgaccatcgcaaaggaggagatc
tttgggccagtgatgcagattctgaagttcaagagcatggaggaagttgttgggagagcc
aacaattccaagtacgggctggctgcagctgtcttcacgaaggacttggacaaagccaat
tatctgtcccaggccctccaggccggcactgtgtgggtcaactgctatgacgtgtttggg
gcccagtcgccgttcggtggctacaagctgtctgggagtggccgggagctgggggaatac
gggctgcaggcatacaccgaagtgaagaccgtcacggtcagagttcctcagaagaactcc
taa

DBGET integrated database retrieval system