KEGG   Ovis aries (sheep): 101120903
Entry
101120903         CDS       T03117                                 

Gene name
ELOA
Definition
(RefSeq) elongin-A isoform X1
  KO
K15076  elongin-A
Organism
oas  Ovis aries (sheep)
Brite
KEGG Orthology (KO) [BR:oas00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:oas03400]
    101120903 (ELOA)
DNA repair and recombination proteins [BR:oas03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    Other NER factors
     101120903 (ELOA)
SSDB
Motif
Pfam: Elongin_A Med26 Pyocin_S
Other DBs
NCBI-GeneID: 101120903
NCBI-ProteinID: XP_027821336
Ensembl: ENSOARG00000007237
LinkDB
Position
2
AA seq 804 aa
MHGGRSRSPRTRREPSSGEEAAPVTAMAAESALQVVEKLQARLATNADPKKLLKYLKKLS
ALPITVDILAETGVGKTVNSLRKHEHVGNFARDLVAQWKKLVPVERTTEPEEQNFEKSSS
RKRPRDALREEAEIEGDYPESWKASSSQSYSPDNRQKKHRKLPELERPHKVSHSHGRRDE
RKRYHRASPVYSSDHESSDYGHVQSPPPSASPHHMSLDHYRSLEEDHEPFVPHQKPGKGH
GNTFQDRLGVSQERHVGEAQGRESASQSKEHRSSHKERRPADAKGDEKASLSKEKSHKVV
SKEENRRPTSGDSTKEKLPSGVRKEKEKEKEGSAKKKVLPPLEVASDNHLKKPKPRDSEK
TRSDKNKQSLENSDVGKGAGDLLPKAKEKVSNNLKTQEGKVKPSHSDRKSVASFPKGEEA
DTDDEFEKPTMSFESYLSYDQPRKKKKKVVKTSTTTPGEKGLKKNDSKSTSKNLDSVQKL
PKVNENKPEKLLPVGADSAKLKKVPSDVLPVLPDLPLPVIQANYRPLPSPELMSSFQPKR
KALSSPQEEEEAGFTGRRMNSKMQVYSGSKCAYLPKMMTLHEQCIRVLKNNIDSIFEVGG
VPYSVLEPVLERCTPDQLYRIEEYNHVLIEETDQLWKVHCHRDFKDERPEEYESWREMYL
RLQDAREQRLRVLTKNIRSAHANKPKGRQAKMAFVNSVAKPPRDVRRRQEKFGTGGAAVP
EKIRIKPAPYPTGSSRASFSSGSSNSFTASPEEPAYDGPSTSGAHPAPVVSSTVSYDPRK
PAVKKIAPMMAKTIKAFKNRFSRR
NT seq 2415 nt   +upstreamnt  +downstreamnt
atgcacggagggcggagccgcagcccgaggacgcgacgcgagcccagttccggcgaggag
gccgcgccagtgacagcgatggcggcggagtcggcgctgcaagttgtggagaagctgcag
gcgcgcctggccacgaacgcagacccgaagaagctattgaaatatttgaagaaactctct
gccctgcccattaccgtagacattcttgcggagactggagttgggaaaacggtgaacagc
ttgcgaaaacatgagcacgtcggaaactttgccagggacctagtggcccagtggaagaag
ctggttcctgtagaacgaaccacagagcctgaggaacagaactttgagaagagcagttct
cggaagcgccccagggatgccctgagggaggaggcagagatagagggggactacccggaa
agctggaaagcctccagcagccagtcgtatagtcctgataatagacagaaaaagcacaga
aaactcccagagctcgagcggcctcacaaagtatctcacagtcatgggaggagagatgaa
agaaagaggtaccacagagcttctccagtttactcttcagaccatgagtcttccgattac
ggccatgttcagtcccctccaccatccgccagccctcatcacatgtctttggaccattac
agatccctggaggaggaccatgagccctttgttccccaccagaagcctggcaaaggccat
ggtaacacctttcaggacagactgggggtcagtcaagaacgacacgtgggggaagcccag
ggcagagaaagcgcgagtcagagcaaggagcacagatcttcccataaagaaagacgtccg
gcggatgccaaaggagacgagaaggcttctctgagcaaagaaaagtcacacaaggtcgtc
tccaaagaggaaaaccggaggccgacctctggggacagcacaaaggagaaactgccctct
ggtgtcaggaaagagaaagagaaggagaaggagggcagcgccaagaagaaggtcttaccc
cccttggaggtggcttcagacaaccaccttaaaaagccaaaacctagagactccgagaaa
accagatcagacaaaaacaagcagagtctagaaaactcggacgtgggcaagggggcagga
gacctgttgcccaaggcaaaagagaaggtttctaacaacctgaagactcaagaagggaaa
gtcaaaccttcgcattcagacagaaagtcggtggcttccttccctaaaggtgaggaggca
gatacggatgatgaatttgagaagcccaccatgtcttttgagtcatacctcagctatgac
cagccccggaagaaaaagaaaaaggttgtaaaaacttcaaccacgactcccggagaaaaa
ggacttaaaaaaaatgattcaaaaagcactagtaaaaacttggactcagttcagaaatta
cctaaggtgaatgaaaacaagcccgagaagcttctgccagttggagccgactcagccaag
ctgaaaaaggtccccagcgatgtgctgccagtattacctgacctcccattacctgtgatc
caggccaattaccgtccacttccttcccctgaattgatgtcatccttccaaccaaagcga
aaagcactctcctcaccccaggaagaggaagaagctggattcaccggaaggagaatgaat
tccaagatgcaggtctattccggttccaagtgtgcctatctgcccaaaatgatgaccttg
cacgagcagtgcatccgggtgcttaaaaacaacattgactcgatctttgaagtgggaggc
gtcccatattctgtccttgaacctgttctggagaggtgtacacctgatcagttgtatcga
atagaagagtacaatcacgtattaattgaagaaacggatcaattatggaaagttcactgt
caccgagactttaaggatgaaaggccagaagagtatgagtcatggcgggagatgtacctg
cggcttcaggatgcgcgagagcagcggctgcgagtcctcacaaagaacatccggtccgca
cacgccaataagcccaaaggccgacaagcaaaaatggcctttgtcaactctgtggccaag
ccacctcgtgatgttcgaaggaggcaggagaaatttggaacaggaggagcagctgtgcct
gaaaaaattaggatcaagccagcgccgtaccccacaggaagcagccgggcttcgttcagc
agtggcagcagcaacagctttaccgccagccccgaggagccggcctacgacggcccgagc
accagtggcgcccacccagccccggtggtcagcagcactgtttcctatgatcctaggaaa
ccggccgtgaagaaaattgccccaatgatggccaagacgattaaagctttcaagaacagg
ttctcccgacgataa

DBGET integrated database retrieval system