Ovis aries (sheep): 443006 Help Entry 443006            CDS       T03117                                  Symbol SST Name (RefSeq) somatostatin precursor   KO K05237   somatostatin Organism oas  Ovis aries (sheep) Pathway oas04024   cAMP signaling pathway oas04080   Neuroactive ligand-receptor interaction oas04935   Growth hormone synthesis, secretion and action oas04971   Gastric acid secretion Brite KEGG Orthology (KO) [BR:oas00001]  09130 Environmental Information Processing   09132 Signal transduction    04024 cAMP signaling pathway     443006 (SST)   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     443006 (SST)  09150 Organismal Systems   09152 Endocrine system    04935 Growth hormone synthesis, secretion and action     443006 (SST)   09154 Digestive system    04971 Gastric acid secretion     443006 (SST)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:oas04052]     443006 (SST) Cytokines and neuropeptides [BR:oas04052]  Neuropeptides   Neuropeptides (GPCR binding)    443006 (SST) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Somatostatin NLRC4_HD2 Motif Other DBs NCBI-GeneID:  443006 NCBI-ProteinID:  NP_001009196 EnsemblRapid:  ENSOARG00020000243 UniProt:  O46688 A0A6P7DSS5 LinkDB All DBs Position 1:200453333..200454581 Genome browser AA seq 116 aa AA seqDB search MLSCRLQCALAALSIVLALGGVTGAPSDPRLRQFLQKSLAAAAGKQELAKYFLAELLSEP NQTENDALEPEDLSQAAEQDEMRLELQRSANSNPAMAPRERKAGCKNFFWKTFTSC NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atgctgtcctgccgcctccagtgcgcgctggccgcgctctccatcgtcctggctcttggc ggtgtcaccggcgcgccctcggatccccgactccgtcagtttctgcagaaatccctggct gctgccgctggcaaacaggaactggccaagtacttcttggcagagctgctgtctgaaccc aaccagacagagaacgatgccctggagcctgaagatttgtcccaggctgctgagcaggat gaaatgaggctggagctgcagagatctgctaactcaaaccccgccatggcaccccgagaa cgcaaagctggctgcaagaatttcttctggaagactttcacatcctgttaa

DBGET integrated database retrieval system