KEGG   Ovis aries (sheep): 494191
Entry
494191            CDS       T03117                                 

Gene name
TGFBR2
Definition
(RefSeq) TGF-beta receptor type-2 isoform X2
  KO
K04388  TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
oas  Ovis aries (sheep)
Pathway
oas04010  MAPK signaling pathway
oas04060  Cytokine-cytokine receptor interaction
oas04068  FoxO signaling pathway
oas04144  Endocytosis
oas04218  Cellular senescence
oas04350  TGF-beta signaling pathway
oas04380  Osteoclast differentiation
oas04390  Hippo signaling pathway
oas04520  Adherens junction
oas04659  Th17 cell differentiation
oas04926  Relaxin signaling pathway
oas04933  AGE-RAGE signaling pathway in diabetic complications
oas05142  Chagas disease
oas05161  Hepatitis B
oas05166  Human T-cell leukemia virus 1 infection
oas05200  Pathways in cancer
oas05202  Transcriptional misregulation in cancer
oas05210  Colorectal cancer
oas05212  Pancreatic cancer
oas05220  Chronic myeloid leukemia
oas05225  Hepatocellular carcinoma
oas05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:oas00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    494191 (TGFBR2)
   04350 TGF-beta signaling pathway
    494191 (TGFBR2)
   04390 Hippo signaling pathway
    494191 (TGFBR2)
   04068 FoxO signaling pathway
    494191 (TGFBR2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    494191 (TGFBR2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    494191 (TGFBR2)
  09143 Cell growth and death
   04218 Cellular senescence
    494191 (TGFBR2)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    494191 (TGFBR2)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    494191 (TGFBR2)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    494191 (TGFBR2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    494191 (TGFBR2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    494191 (TGFBR2)
   05202 Transcriptional misregulation in cancer
    494191 (TGFBR2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    494191 (TGFBR2)
   05212 Pancreatic cancer
    494191 (TGFBR2)
   05225 Hepatocellular carcinoma
    494191 (TGFBR2)
   05226 Gastric cancer
    494191 (TGFBR2)
   05220 Chronic myeloid leukemia
    494191 (TGFBR2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    494191 (TGFBR2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    494191 (TGFBR2)
   05161 Hepatitis B
    494191 (TGFBR2)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    494191 (TGFBR2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:oas01001]
    494191 (TGFBR2)
Enzymes [BR:oas01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     494191 (TGFBR2)
Protein kinases [BR:oas01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   494191 (TGFBR2)
SSDB
Motif
Pfam: ecTbetaR2 PK_Tyr_Ser-Thr Pkinase Pkinase_fungal APH
Other DBs
NCBI-GeneID: 494191
NCBI-ProteinID: XP_011954699
LinkDB
Position
19
AA seq 471 aa
MGRGLLGGLWPLHVVLWTRIASTIPPHVPKSVNSDLVVTDHSGAVKLSQLCKFCDVRSST
CDNQKSCWSNCSITAICEKPEEVCVAVWRKNDENITLETVCHDPKIAYHGFVLDDAASPK
CIMKERKGSGETFFMCSCSAEECNDHIIFSEEYTSSNPDLLLVIFQVTGVSLLPPLGIAT
AVIVIFYCYRTHRQQKLSPAWDSGKPRKLMEFSEHLAIILEDDRSDISSTCANNINHNTE
LLPIELDTLVGKGRFAEVYKAKLRQNTSEQFETVAVKIFPYEEYASWKTEKDIFSDINLK
HENILQFLTAEERKTELGKQYWLITAFHAKGNLQEYLTRHVISWEDLRRLGGSLARGIAH
LHSDHTLCGRPKMPIVHRDLKSSNILVKGDLTCCLCDFGLSLRLDPTLSVDDLANSGQVG
TARYMAPEVLESRMNLENVESFKQTDVYSMALVLWEMTSRCNAVGALTAPE
NT seq 1416 nt   +upstreamnt  +downstreamnt
atgggccgggggctgctcgggggcctgtggccgctgcacgtcgtcctgtggacgcgcatc
gccagcacgatcccgccgcacgttcccaagtcggttaacagcgacctggtggtcaccgat
cacagcggggccgtcaagctgtcgcagctgtgcaagttctgtgacgtgcggtcgtccacc
tgcgacaaccagaagtcctgctggagcaactgcagcatcacggccatctgcgagaagccg
gaggaggtctgcgtggctgtctggaggaagaatgatgagaacatcacgctggagacggtc
tgccacgaccccaagattgcctaccatggatttgtcctggacgatgctgcttctccgaag
tgcatcatgaaggaaagaaaggggtctggagagactttcttcatgtgctcctgcagcgct
gaagagtgcaacgaccacatcatcttctccgaagagtacaccagcagtaaccccgacttg
ctgctggtcatcttccaagtgacaggcgtcagcctcctgccaccgctgggcatcgccacc
gcagtcatcgtcattttctactgctaccgcacccaccggcagcagaagctgagcccagcc
tgggactcgggcaagccgcgcaagctgatggagttcagcgagcacctggccatcatcctg
gaggacgaccgctctgacatcagctccacctgcgccaacaatatcaaccacaacacggag
ctgctgcccatcgagctggacaccctggtgggcaaggggcgcttcgccgaggtctacaag
gccaagctgaggcagaacacgtctgagcagtttgagaccgtggccgtcaagatcttcccc
tacgaggagtatgcctcctggaagacggagaaggacatcttctcggacatcaacctcaag
cacgagaacatcctgcagttcctaacggccgaggagcgcaagacggagctgggcaagcag
tactggctcatcactgccttccacgccaagggcaacctgcaggagtacctgacgcgccac
gtcatcagctgggaggacctgcgccggctaggcggctcactggcccgcggcatcgcgcac
ctgcacagcgaccacacgctgtgcggccggcccaagatgcccatcgtgcacagggacctc
aagagctccaacatcctggtcaagggcgacctcacctgctgcctctgcgacttcgggctc
tctctgcggctggaccccaccctgtcggtagatgacctggccaacagtgggcaggtggga
acggcgagatacatggctccagaggtcctcgagtccaggatgaatctggagaatgtcgag
tccttcaagcagacggatgtctactccatggccctggtgctctgggagatgacgtctcgc
tgcaacgccgtgggagctttgacagctccagaatga

DBGET integrated database retrieval system