KEGG   Osmia bicornis bicornis: 114877029
Entry
114877029         CDS       T06109                                 

Definition
(RefSeq) fibroblast growth factor 1-like
  KO
K18496  fibroblast growth factor 1
Organism
obb  Osmia bicornis bicornis
Brite
KEGG Orthology (KO) [BR:obb00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:obb04052]
    114877029
   00536 Glycosaminoglycan binding proteins [BR:obb00536]
    114877029
Cytokines and growth factors [BR:obb04052]
 Growth factors
  Growth factors (RTK binding)
   114877029
Glycosaminoglycan binding proteins [BR:obb00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   114877029
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 114877029
NCBI-ProteinID: XP_029044947
LinkDB
Position
Unknown
AA seq 232 aa
MSLRWIHENLEAPTCDEECSDIDDSCSDDSYDSDLSIGEEKGTGNEKEINGDRRWKKESR
RHSTATMKFDENGKSRYITNESVKPPPCVIWDPRKPAQNPVYNCLVIKLFCRTGYHLGVS
ESGRVRGLSATNEPHGLLHIIPVSFGVIRIQSIKTSLYLAFNKKGRLYGEPNANKETTEW
EQWNIGSYDAFRSKKYANYGWWIGIKKNGRAKPGSKTRWGQKAIQFLAIRQE
NT seq 699 nt   +upstreamnt  +downstreamnt
atgagtcttcgttggattcacgaaaacttagaagcaccgacatgcgacgaagaatgcagc
gacatcgatgatagttgcagcgacgacagctatgattccgatctatcgatcggcgaggag
aaaggaacaggaaacgagaaagagatcaatggggatcgcagatggaaaaaggaaagcaga
cgacactcgacggctacaatgaagttcgacgagaatggaaagtcacgttacatcaccaac
gaatcagttaaacctcctccttgcgtaatatgggatcccaggaaaccagctcagaatccg
gtgtacaattgtttggtaattaaactattttgccgaactggttatcaccttggtgtttcg
gaatcgggtcgtgttagagggttgagtgctacaaacgaaccacacggcttgcttcatatc
ataccggtttctttcggcgtgattcgaatacaaagtatcaagactagtctgtatctggct
ttcaacaagaaaggacgcttatacggggaaccaaatgcaaataaggagaccacagaatgg
gaacaatggaacattggttcctatgatgcttttcgctcaaaaaagtacgctaattatgga
tggtggatagggataaagaagaatgggcgagcaaaaccaggatcaaaaacacgatgggga
cagaaagcgatacaatttttagcaatacgacaagaataa

DBGET integrated database retrieval system