KEGG   Opitutaceae bacterium TAV5: OPIT5_20420
Entry
OPIT5_20420       CDS       T03683                                 

Definition
(GenBank) hypothetical protein
  KO
K20370  phosphoenolpyruvate carboxykinase (diphosphate) [EC:4.1.1.38]
Organism
obt  Opitutaceae bacterium TAV5
Pathway
obt00620  Pyruvate metabolism
obt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:obt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    OPIT5_20420
Enzymes [BR:obt01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.38  phosphoenolpyruvate carboxykinase (diphosphate)
     OPIT5_20420
SSDB
Other DBs
NCBI-ProteinID: AHF92257
UniProt: W0J1B2
LinkDB
Position
complement(4809363..4812866)
AA seq 1167 aa
MSETNTTHTASTELLPQLPDARDPRILAYLNLKLREIGQPTIALPDSDADHLAGLVDHLL
TLSREKDRLLTRHFCPVDQRIQNYLYATFEEHGGAPRLPAQTLVLDRPGLARALSLPPSA
DEHKSPILSSYRLHNGVLHNPKSDRRTTKGIFHVTEGGLPIPDDKKAVPAAVFARLLRHA
FNPPSELLQLPFTAGQATAAECFVSLYQRPVVVPEVAGFTPRRSMETRFFVPGSLVANLD
FVESVFGNAGDPHLPANDAALDPEHWTGHTGCIILAPHLSASLTKKELGLPAWDDATDRQ
RRDGMAWKKPDELYNDGVAFKITSRDASGVIVTILSDNYFGYCKKEIKTQISYAANLLGS
AEEEHSGGAIAFASYDLGENFRLTNLYPDNDYTLAGALTLLGANATPQPGGWARDNVYPD
IYYIPESARFDLRTQSVIWSDSASEARPDLKLLPGITYIYPNGYRVEMVNPDRRRWRLRG
SSPSGLLCHKPCTVSGGGKSEISKSIADATFSGPIFISDPVRDIELVRELLHKNYYGRYK
DASRNTTPSRPILSPARSLGSVVKLLSRSPDYTDEYNAWLTTIPRYVRDIVLLVKRLYKP
EWGEEWASNFSVDTINGRPGNEIKYHGIRATTQFLRIGYTATGGWRTFSLRSDFLPAIKI
QVEDDITASTVAPLADVKGLPRFPERGGASVKLVHNCETRLFQRPDDAIIRGYDRHTEED
FAKPDTYFSNYEPLDRAAAAEIISDTLGFDAFTQPVRDLFKEFASHPRAAFLASPAHPRI
VDGKPTKNPRYLQVRPDLLDPRATRVAHAAARLRRRLAADDPVTFPVGAVLMGRRLNPPE
AGVRPLCVFNPIHYQELPEAFMDLIASLTGKSPSTTGAGSEGALTKGPFNALPPIYDLNS
ALVSFLLTDLPAFSTAAGWVGPKLRVDHDISLLVPEIWCRMTRPERDPKNLISKGYFERC
QDFVHNGKPVLASRLGYRITARGVQTFFGRVLSNPSTVFDEEFLKPELQDMDVFAEGMAN
IVEAMKTAAESYFADGSIQDACPPLKALLHIMRDGAWEGHGPDAPEFRALFDREQMLKSD
WYHARLEARRQIDAATWDEHARYLEKFLHKHNYADVALQLDIKSRLTRVTDHARAAARPD
YLKKIRGTLGSEPAVAAGIVAARESTR
NT seq 3504 nt   +upstreamnt  +downstreamnt
atgagcgaaaccaacaccacccacacggcctccaccgaactcctcccgcagcttcccgac
gcccgcgaccctcgcatcctcgcctacctcaacctcaagttgcgcgagatcggccagccc
accatcgccctgcccgattccgacgccgaccacctcgccggcctcgtcgaccacctgctc
acgctcagccgcgaaaaagaccgcctcctcacccgccacttctgccccgtcgaccagcgc
atccagaactacctctacgccaccttcgaggaacacggcggcgcgccccgcctccccgcg
cagacgctggtcctcgaccgccccggcctcgcccgcgccctctctctcccgccctccgcc
gacgaacacaaaagccccatcctctcctcgtaccgcctccacaacggcgtcctccacaac
cccaagtccgaccgccgcaccaccaagggcattttccacgtcaccgaaggcggcctcccc
atccccgacgacaagaaagccgtcccggccgccgtcttcgcgcgcctcctgcgccacgcc
ttcaacccgccttccgagctcctgcaactccccttcaccgccggccaggccaccgccgcc
gagtgcttcgtctcgctctatcagcgccccgtcgtcgtccccgaagtcgccggcttcacc
ccgcgccgctccatggaaacgcgcttcttcgtccccggctcgctcgtcgccaacctcgac
tttgtcgaaagcgtcttcggcaacgccggcgacccccacctccccgccaacgacgccgcc
ctcgatcccgaacactggaccggccacaccggctgcatcatcctcgccccgcatctcagc
gccagcctcaccaaaaaggaactcggcctccccgcatgggacgacgccaccgatcgccag
cgccgcgacggcatggcgtggaaaaagcccgacgaactctacaacgacggcgtcgccttc
aagatcacctcccgcgacgcctccggcgtcatcgtcaccatcctctccgacaactacttc
ggttactgcaagaaagagatcaagacccagatctcctacgcggccaacctgctcggctcc
gccgaggaggagcactccggcggcgccatcgccttcgccagctatgacctcggcgaaaac
ttccggctcaccaacctgtatcccgacaatgattacaccctcgccggcgccctcactctc
ctcggcgccaacgccaccccgcagcccggcggctgggcgcgcgacaacgtgtaccccgac
atctactacataccggaatccgcccgcttcgacctgcgcacccagagcgtcatctggagc
gacagcgcatccgaggcccggcccgacctgaaactcctccccggcatcacctacatctac
cccaacggctaccgcgtcgagatggtcaaccccgaccgccgccgctggcgcctgcgcggc
tccagccccagcgggctcctctgccacaaaccctgcaccgtctccggcggcggcaagtcc
gagatctcgaaatccatcgccgacgccaccttctccggcccgatcttcatctccgacccc
gtgcgcgacatcgagctcgtccgcgaacttctccacaaaaactactacggccgctacaag
gacgcctcccgcaataccacgcccagccgccccatcctcagtccggcgcgttccctcggc
tccgtcgtcaagctcctcagccgcagccccgactacaccgacgagtacaacgcctggctc
accaccatcccgcgctacgtccgcgacatcgtcctcctcgtcaaacgcctctacaaaccc
gagtggggcgaggagtgggccagtaatttctccgtggatacgatcaacggccgtcccggc
aacgagatcaagtaccacggcatccgcgccaccacgcagtttctccgcatcggctacacg
gccaccggcggctggcgcaccttctcgctccgcagcgatttcctccccgccatcaagatc
caggtcgaggacgacatcaccgcgtccaccgtcgccccgctcgccgacgtcaagggcctc
ccccgcttccccgaacgcggcggcgcctcggtcaagctcgtccataactgcgaaacccgc
ctcttccagcggcccgacgacgccatcatccgcggctacgaccgccacaccgaggaagac
ttcgccaagcccgacacctatttctccaactacgagccgctcgaccgcgccgccgccgcg
gagatcatcagcgacacgctcggcttcgacgccttcacgcagcccgtgcgcgatctcttc
aaggagttcgcctcgcacccgcgcgccgccttcctcgcctcgcccgcgcatccgcgcatc
gtggacggcaaaccgaccaaaaacccgcgctacctccaggtccgccccgatcttctcgat
ccgcgcgccacccgcgtagcccacgccgccgcccgcctgcgccgccgcctcgccgccgac
gatcccgtcaccttccccgtcggcgccgtcctcatgggccgccgtctcaacccgcccgag
gccggcgtccgccccctctgcgtgttcaaccccatccactaccaggagttgcccgaggcg
ttcatggatctcatcgccagcctcaccggcaagtcgccctccaccaccggagccggctcc
gaaggcgcgctgaccaagggcccgttcaacgccctgccgccgatctacgacctcaattcg
gcgctcgtctcgttcctcctcaccgatctgcccgccttctccaccgccgccggctgggtc
ggccccaagctccgtgtcgatcacgacatcagcctcctcgtcccggaaatctggtgccgc
atgacgcgccccgagcgcgacccgaagaacctcatttccaagggctacttcgagcgctgc
caggattttgtccacaacggcaaacccgtcctcgcctcgcgcctcggctatcgcatcacc
gcgcgcggcgtgcagacgttcttcggccgcgtcctcagcaacccgagcaccgttttcgac
gaggaattcctgaagcccgagctgcaggacatggacgtcttcgccgaaggcatggccaac
atcgtcgaggcgatgaagaccgccgccgaaagctactttgccgacggctccatccaggac
gcctgcccgccgctcaaggccctcctgcacatcatgcgtgacggcgcctgggaaggccac
ggacccgacgctccggaattccgcgcgctcttcgaccgcgagcagatgctgaagagcgac
tggtaccatgcccgcctcgaagcccgccgccagatcgacgccgccacctgggacgagcat
gcccggtacctggaaaagttcctgcacaagcacaactacgccgacgtggcgctccagctc
gacatcaagagccgtctcacccgcgtgaccgatcatgcccgcgccgccgcccggcccgat
tatctcaaaaaaatccgcggcacgctcggcagcgaacccgccgtcgccgccggcatcgtc
gccgcccgcgaaagcacccggtaa

DBGET integrated database retrieval system