KEGG   Oryctolagus cuniculus (rabbit): 100008939
Entry
100008939         CDS       T03373                                 

Gene name
ITPR3
Definition
(RefSeq) inositol 1,4,5-trisphosphate receptor type 3
  KO
K04960  inositol 1,4,5-triphosphate receptor type 3
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04020  Calcium signaling pathway
ocu04022  cGMP-PKG signaling pathway
ocu04070  Phosphatidylinositol signaling system
ocu04114  Oocyte meiosis
ocu04210  Apoptosis
ocu04218  Cellular senescence
ocu04270  Vascular smooth muscle contraction
ocu04371  Apelin signaling pathway
ocu04540  Gap junction
ocu04611  Platelet activation
ocu04621  NOD-like receptor signaling pathway
ocu04625  C-type lectin receptor signaling pathway
ocu04713  Circadian entrainment
ocu04720  Long-term potentiation
ocu04723  Retrograde endocannabinoid signaling
ocu04724  Glutamatergic synapse
ocu04725  Cholinergic synapse
ocu04726  Serotonergic synapse
ocu04728  Dopaminergic synapse
ocu04730  Long-term depression
ocu04742  Taste transduction
ocu04750  Inflammatory mediator regulation of TRP channels
ocu04911  Insulin secretion
ocu04912  GnRH signaling pathway
ocu04915  Estrogen signaling pathway
ocu04918  Thyroid hormone synthesis
ocu04921  Oxytocin signaling pathway
ocu04922  Glucagon signaling pathway
ocu04924  Renin secretion
ocu04925  Aldosterone synthesis and secretion
ocu04927  Cortisol synthesis and secretion
ocu04928  Parathyroid hormone synthesis, secretion and action
ocu04929  GnRH secretion
ocu04934  Cushing syndrome
ocu04935  Growth hormone synthesis, secretion and action
ocu04970  Salivary secretion
ocu04971  Gastric acid secretion
ocu04972  Pancreatic secretion
ocu05010  Alzheimer disease
ocu05012  Parkinson disease
ocu05014  Amyotrophic lateral sclerosis
ocu05017  Spinocerebellar ataxia
ocu05020  Prion disease
ocu05022  Pathways of neurodegeneration - multiple diseases
ocu05163  Human cytomegalovirus infection
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05170  Human immunodeficiency virus 1 infection
ocu05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100008939 (ITPR3)
   04020 Calcium signaling pathway
    100008939 (ITPR3)
   04070 Phosphatidylinositol signaling system
    100008939 (ITPR3)
   04022 cGMP-PKG signaling pathway
    100008939 (ITPR3)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100008939 (ITPR3)
   04210 Apoptosis
    100008939 (ITPR3)
   04218 Cellular senescence
    100008939 (ITPR3)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100008939 (ITPR3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100008939 (ITPR3)
   04621 NOD-like receptor signaling pathway
    100008939 (ITPR3)
   04625 C-type lectin receptor signaling pathway
    100008939 (ITPR3)
  09152 Endocrine system
   04911 Insulin secretion
    100008939 (ITPR3)
   04922 Glucagon signaling pathway
    100008939 (ITPR3)
   04929 GnRH secretion
    100008939 (ITPR3)
   04912 GnRH signaling pathway
    100008939 (ITPR3)
   04915 Estrogen signaling pathway
    100008939 (ITPR3)
   04921 Oxytocin signaling pathway
    100008939 (ITPR3)
   04935 Growth hormone synthesis, secretion and action
    100008939 (ITPR3)
   04918 Thyroid hormone synthesis
    100008939 (ITPR3)
   04928 Parathyroid hormone synthesis, secretion and action
    100008939 (ITPR3)
   04924 Renin secretion
    100008939 (ITPR3)
   04925 Aldosterone synthesis and secretion
    100008939 (ITPR3)
   04927 Cortisol synthesis and secretion
    100008939 (ITPR3)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100008939 (ITPR3)
  09154 Digestive system
   04970 Salivary secretion
    100008939 (ITPR3)
   04971 Gastric acid secretion
    100008939 (ITPR3)
   04972 Pancreatic secretion
    100008939 (ITPR3)
  09156 Nervous system
   04724 Glutamatergic synapse
    100008939 (ITPR3)
   04725 Cholinergic synapse
    100008939 (ITPR3)
   04728 Dopaminergic synapse
    100008939 (ITPR3)
   04726 Serotonergic synapse
    100008939 (ITPR3)
   04720 Long-term potentiation
    100008939 (ITPR3)
   04730 Long-term depression
    100008939 (ITPR3)
   04723 Retrograde endocannabinoid signaling
    100008939 (ITPR3)
  09157 Sensory system
   04742 Taste transduction
    100008939 (ITPR3)
   04750 Inflammatory mediator regulation of TRP channels
    100008939 (ITPR3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100008939 (ITPR3)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100008939 (ITPR3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100008939 (ITPR3)
   05012 Parkinson disease
    100008939 (ITPR3)
   05014 Amyotrophic lateral sclerosis
    100008939 (ITPR3)
   05017 Spinocerebellar ataxia
    100008939 (ITPR3)
   05020 Prion disease
    100008939 (ITPR3)
   05022 Pathways of neurodegeneration - multiple diseases
    100008939 (ITPR3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100008939 (ITPR3)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100008939 (ITPR3)
   05163 Human cytomegalovirus infection
    100008939 (ITPR3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100008939 (ITPR3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ocu01009]
    100008939 (ITPR3)
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:ocu04040]
    100008939 (ITPR3)
Protein phosphatases and associated proteins [BR:ocu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100008939 (ITPR3)
Ion channels [BR:ocu04040]
 Ligand-gated channels
  IP3 receptor
   100008939 (ITPR3)
SSDB
Motif
Pfam: RYDR_ITPR RIH_assoc Ion_trans SopA
Other DBs
NCBI-GeneID: 100008939
NCBI-ProteinID: XP_017200534
Ensembl: ENSOCUG00000005766
LinkDB
Position
12
AA seq 2296 aa
MLGTCPTKEDKEAFAIVSVPVSEIRDLDFANDASSMLASAVEKLSEGFISQNDRRFVIQL
LEDLVFFVSDVPNNGQNVLDVMVTKPNRERQKLMREQNILKQIFGILKAPFRDKGGEGPL
VRLEELSDQKNAPYQHMFRLCYRVLRHSQEDYRKNQEHIAKQFGMMQSQIGYDILAEDTI
TALLHNNRKLLEKHITKTEVETFVSLVRKNREPRFLDYLSDLCVSNHIAIPVTQELICKC
VLDPKNSDILIQTELRPVKEMAQSHEYLSIEYSEEEVWLTWTDRNNEHHEKSVRQLAQEA
RAGNAHDENVLSYYRYQLKLFARMCLDRQYLAIDEISQQLGVDLIFLCMADEMLPFDLRA
SFCHLMLRVHVDRDPQELVTPVKFARLWTEIPTAITIKDYDSNLNASRDDKKHKFASTME
FVEDYLNGVVSEAVPFANEEKNKLTFEVVSLAHNLIYFGFYSFSELLRLTRTLLSIIDCV
QGPPAMLQAYEDPGGKNVRRSIQGVGHMMSTMVLSRKQSVFGGPGLPAGAGAAEPLDRSK
FEENEDIVVMETKLKILEILQFILNVRLDYRISYLLSVFKKEFVEVFPMQDSSADGTAPA
FDSTTANMNLDRIGDQAEAMFGVGKSNSMLEVDDEGGRMFLRVLIHLTMHDYAPLVSGAL
QLLFKHFSQRQEAMHTFKQVQLLISAQDVENYKVIKSELDRLRTMVEKSELWVDKKGSGK
GEEVEAGATKDKKERPMDEEGFLPPAGEKSSENYQIVKGILERLNKMCGVGEQMRKKQQR
LLKNMDAHKVMLDLLQVPYDKGDAKMVEILRYTHQFLQKFCAGNPGNQALLHKHLHLFLT
PGLLEAETMQHIFLNNYQLCSEISEPVLQHFVHLLATHGRHVQYLDFLHTVIKAEGKYVK
KCQDMIMTELTNAGDDVVVFYNDKASLAHLLEMMKGARDGVEDQSPLMYHISLVDLLAAC
AEGKNVYTEIKCTSLLPLEDVVSVVTHEDCITEVKMAYVNFVNHCYVDTEVEMKEIYTSN
HIWTLFESFTLDMARVCSKREKRLADPTLEKYVLTVVLDTVHAFFSSPFSENSTSLQTHQ
TIVVQLLQSTMRLLECPWLQQQHKGSVEACIRTLAMVAKSRAILLPMDLDAHISSLLSSG
ASCAAAAQRNASNYKAATRAFPRVAPTANQWDYKNIIEKLQDIITALEERLRPLVQAELS
VLVDVLHWPELLFLEGSEAYQRCEKWRLPVQVSGARWPGPGRGWGGQRALEGWRRGVGGV
FCLGGGVGPARASSGRRRLIQHTKDLVESEEKLCIKVLRTLQQMLLKKTKYGERGNQLRK
MLLQNYLQNRKSSSRGDLPDPMGIGLDQDWSAIAATQCRLDKEGATKLVCDLITSTKNEK
IFQESIGLAIRLLDGGNTEIQKSFYNLMTSDKKSERFFKVLHDRMKRAQQETKSTVAVNM
NDLGSQPREDPTAKGRVASFSMPSSSSRYSLGPSLPRGHEVGERVQSEMGTSVLIMQPIL
RFLQLLCENHNRDLQNYLRCQNNKTNYNLVCETLQFLDIMCGSTTGGLGLLGLYINEDNV
GLVIQTLETLTEYCQGPCHENQTCIVTHESNGIDIITALILNDISPLCKYRMDLVLQLKD
NASKLLLALMESRHDSENAERILISLRPQELVDVIKKAYLQEEERENSEVSPREVGHNIY
ILALQLSRHNKQLQNLLRPVRRIQEEEAEGISSMLSLNNKQLSQMLKSSAPAQEEEEDPL
AYYENHTSQIEIVRQDRSMEQIVFPVPGICQFLTEETKHRLFTTTEQDEQGSKVSDFFDQ
SSFLHNEMEWQRRLRSMPLIYWVSRRMTLWGSISFNLAVFINIIIAFFYPYVEGASTGVL
GSPLMSLLFWILICFSVTALFTKRYSIRPLIVALILRSIYYLGIGPTLNILGALNLTNKI
VFVVSFVGNRGTFIRGYKAMVMDVEFLYHVGYILTSVLGLFAHELFYSILLFDLIYREET
LFNVIKSVTRNGRSILLTALLALILVYLFSIVGFLFLKDDFILEVDRLPSNHSRASPLAM
PHGAAAFVGTCSGDKMDCVSGVSVPEALEDGELDSTERACDTLLMCIVTVMNHGLRNGGG
VGDILRKPSKDESLFPARVVYDLLFFFIVIIIVLNLIFGVIIDTFADLRSEKQKKEEILK
TTCFICGLERDKFDNKTVSFEEHIKLEHNMWNYLYFIVLVRVKNKTDYTGPESYVAQMIK
NKNLDWFPRMRAMSLVSNEGEGEQNEIRILQDKLNSTMKLVSHLTAQLNELKEQMTEQRK
RRQRLGFVDVQNCMSR
NT seq 6891 nt   +upstreamnt  +downstreamnt
atgctgggcacctgccccaccaaggaggacaaggaggcctttgccatcgtgtcagtgccc
gtgtccgagattcgtgacctggactttgccaacgatgccagctccatgctggccagtgcc
gtggagaagctcagcgaaggcttcatcagccagaatgaccgcaggtttgtcattcagctg
ctggaggacctggtgttctttgtcagcgacgtccccaacaatgggcagaatgtgctggac
gtcatggtcaccaagcccaaccgggagcggcagaagctgatgagggagcagaacatcctc
aaacagatcttcggcattctgaaggccccgttccgcgacaaggggggcgagggccccctg
gtgcggctggaggagctgtcagaccagaagaacgccccgtaccagcacatgttccgcctc
tgctaccgcgtgctgcgccactcccaggaggactaccgcaagaaccaggagcacattgcc
aagcagtttgggatgatgcagtcccagatcggctacgacatcctggccgaggacaccatc
accgcactcctgcacaacaaccgcaaactgctggagaagcacatcaccaagaccgaggtg
gagaccttcgtcagcctcgtgcgcaagaaccgcgagcccaggttcctggactacctctct
gacctgtgcgtgtccaaccacatcgccatccccgtgacgcaggagctcatctgcaagtgt
gtgctggaccccaagaacagcgacatcctcatccagaccgagctgcggcccgtgaaggag
atggcacagtcccatgagtacctgagcatcgagtactcggaggaggaagtgtggctcacg
tggaccgacaggaataatgagcaccacgagaagagcgtgaggcagctggcccaggaggcg
cgcgccggcaacgcccacgacgagaacgtgctcagctactacaggtaccagctgaagctc
ttcgcccgcatgtgcctggatcggcagtacctggccatcgacgagatctcccagcagctg
ggcgtggacctgatcttcctgtgcatggccgacgagatgctgcccttcgacctgcgcgcc
tccttctgccacctgatgctgcgcgtgcacgtggaccgcgacccgcaggagctggtgacg
cccgtcaagttcgcccgtctctggactgagatccccacagccatcaccatcaaggactac
gattccaacctcaatgcctcgcgagatgacaagaagcacaagttcgccagcaccatggag
ttcgtggaggactacctcaacggcgtcgtcagcgaggccgtgcccttcgccaacgaggag
aagaacaagctcaccttcgaggtggtcagcctggcacacaacctcatctacttcggcttc
tacagcttcagcgagctgctgcggctcactcgcacgctgctcagcatcatcgactgcgtg
cagggacccccggccatgctgcaggcctacgaggacccaggaggcaagaatgtgcggcgc
tccatccagggcgtgggccacatgatgtccaccatggtgctcagccgcaagcagtctgtc
ttcggcggccccggcctgcccgccggcgctggcgccgcggagccgctggaccggagcaag
ttcgaggagaatgaagacatcgtggtgatggagaccaagctgaagatcctggagatcctg
cagttcatccttaacgtccgcctggactaccgcatctcctacctgctgtctgtcttcaag
aaggagttcgtggaggtgtttcccatgcaggacagcagcgcggacggcacggcccccgcc
ttcgactccaccactgccaacatgaacctggaccgcattggggaccaggcagaggccatg
tttggagtggggaagagcaacagcatgctggaagtggacgacgagggcggccgcatgttc
ctgcgggtgctcatccacctgaccatgcacgactacgccccgctcgtctcgggcgccctc
cagctgctcttcaagcacttcagccagcgccaggaggccatgcacacgttcaaacaggtg
cagctgctcatctcagcccaggacgtggagaactacaaggtgatcaagtccgagctggac
cggctgcggaccatggtggagaagtcagagctgtgggtggacaagaagggcagcggcaag
ggcgaggaggtggaggcgggggccaccaaggacaagaaggagcggcccatggatgaagag
ggcttcctgcccccggctggggagaagagcagcgagaactaccagatcgtcaagggcatc
ctggagcggctgaacaagatgtgcggggtcggcgagcagatgaggaagaagcagcagcgg
ctgctcaagaacatggacgcccacaaggtcatgctggacctgctgcaggtcccctacgac
aagggcgacgccaagatggtggagatcctgcgctacacacaccagttcctgcagaagttc
tgtgcgggcaaccccggcaaccaggccctgctgcacaagcacctgcacctcttcctcacg
ccggggctcctggaggcggagaccatgcagcacatcttcctgaacaactaccagctgtgc
tcggagatcagcgagcccgtgctgcagcacttcgtgcacctgctggccacccacgggcgc
cacgtgcagtacctggacttcctgcacaccgtcatcaaggccgagggcaagtacgtcaag
aagtgccaggacatgatcatgaccgagctgaccaacgcaggggacgacgtggttgtgttc
tacaatgacaaggcctcactggcccacctgctagagatgatgaagggcgcccgggatggc
gtggaggaccagagccccctcatgtaccacatctccctggtggacctgctggccgcctgc
gccgagggcaagaacgtctacacggagatcaagtgcacctccctgctgcccctggaggat
gtggtgtcggtggtgacacacgaggactgcatcactgaggtgaaaatggcctacgtgaac
ttcgtgaaccactgctacgtggacacggaggtggagatgaaggagatctacaccagcaac
cacatctggacgctcttcgagagcttcaccctggacatggctcgggtgtgcagtaagcgg
gagaagcggctggccgaccccaccctcgagaagtacgtgctgaccgtggtgctggacacg
gtccacgccttcttcagctccccgttctccgagaacagtacctccctgcagacgcatcag
acaatcgtggtccagctgctgcagtccaccatgcggctgctcgagtgtccgtggctgcag
cagcagcacaagggctcggtggaggcctgcatccggaccctcgccatggtggccaagagt
cgggccatcctgctgcccatggacctggacgcccacatcagctcgctgctgagcagcggg
gccagctgtgcggctgccgcccagcggaacgcatccaactacaaggcggccacgcgggcc
ttcccccgcgtcgcccccaccgccaaccagtgggactacaagaacatcatcgagaagctg
caggacatcatcacagccctggaggagcggctgaggcccctggtgcaggcggagctgtcc
gtgctggtggacgtcctgcactggcccgagctgctcttcctggagggcagcgaagcctac
cagcgctgcgagaagtggcggcttcctgtccaagtgagcggggcccggtggcctgggcca
gggaggggctgggggggtcagcgggccctggaggggtggaggcggggggtggggggagtg
ttttgcctgggaggcggcgtggggccggcccgagcttcctctggccgccgcaggctgatc
cagcacaccaaggacctcgtggagtccgaggagaagctgtgcatcaaggtgctgcgcacc
ctgcagcagatgctgctcaagaagaccaagtacggggagcggggcaaccagctgcgcaag
atgctgctgcagaactacctgcagaaccggaagtccagctcgcggggggaccttccggac
cccatgggcatcggcctggaccaagactggtcagccatcgcggccacccagtgccggctg
gacaaggagggggccaccaagctggtgtgtgacctcatcaccagtaccaagaacgagaag
atcttccaggagagtatcggcctggccatccgcctgctggacggtggcaacacggagatc
cagaaatccttctacaacctgatgaccagcgacaagaagtcggagcgcttcttcaaggtg
ctgcatgaccgcatgaagcgggcgcagcaggagaccaagtccacagtggctgtgaacatg
aacgacctgggcagccagccgcgggaagaccccacggccaaaggccgtgtggcttccttc
tccatgcccagctcctcctcccgctactcgctgggccccagcctgccccgggggcacgag
gtgggcgagcgcgtgcagagtgagatgggcacctccgtgctcatcatgcagcccatcctg
cgcttcctgcagctgctgtgcgagaaccacaaccgggacctgcagaactacctgcgctgt
cagaacaacaagaccaactacaacctggtgtgcgagaccctgcagttcctggacatcatg
tgcggcagcaccacgggggggctggggctgctggggctctacatcaacgaggacaacgtg
ggcctcgtcatccagaccttggagaccctcaccgagtactgccagggcccctgccatgag
aaccagacctgcatcgtgacgcacgagtccaacggcatagacatcatcaccgccctgatc
ctcaatgacatcagccccctgtgcaagtaccgtatggatctggtgctgcagctcaaggac
aacgcctccaagctgctgttggcactgatggagagccggcacgacagcgagaacgccgag
cgcatcctcattagcctgcggccccaggagctggtggacgtcatcaagaaggcctacctg
caggaggaggagcgtgagaactcggaggtgagcccacgagaagtgggccacaacatctac
atcctggcactgcagctctccaggcacaacaaacagctgcagaacctgctgaggcccgtg
aggcgcatccaagaggaggaagccgagggcatctcttccatgctcagcctgaacaacaag
cagctgtcacagatgctcaagtcctcggcgcccgcgcaggaggaggaagaggaccccctg
gcctactacgagaaccacacgtcgcagatcgagatcgtgcggcaggaccgcagcatggag
cagatcgtgttcccggtgcctggcatctgccagttcctgacggaggagaccaagcaccgg
ctcttcaccaccaccgagcaggacgagcagggcagcaaagtgagcgacttcttcgaccag
tcctccttcctgcacaacgagatggagtggcagcgccggctccgcagcatgccgctcatc
tactgggtctcgcgccgcatgaccctgtggggcagcatctccttcaacctggccgtgttc
atcaacatcatcatcgccttcttctacccttacgtggagggcgcgtccacaggcgtgctg
ggctccccgctcatgtcgctgctcttctggatcctcatctgcttctccgtcacggccctg
ttcaccaagcgctacagcatccgcccgctcatcgtggcgctcatcctgcgctccatctac
tacctgggcatcgggcccacgctcaacatcttgggtgccctcaacctgaccaacaagatc
gtgtttgtggtgagcttcgtgggcaaccgtggcaccttcatccgtggctacaaggccatg
gtcatggacgtggaattcctctaccatgtgggctacatcctgaccagtgtcctgggcctc
ttcgcccatgagctcttctacagcatcctgctctttgacctcatctaccgggaggagacg
ctgttcaacgtcatcaagagcgtgacccgcaacggccgctccatcctgctcacggcgctg
ctggcgctcatcctggtctacctcttctccatcgtgggcttcctcttcctcaaggacgac
ttcatcctggaggtcgaccggctgcccagcaaccactccagagccagccccctggcgatg
ccacacggagctgccgcgtttgtgggcacgtgcagcggggacaagatggactgtgtctcc
ggggtgtcggtgcctgaggccctggaagacggggagctggacagcacggagcgggcctgc
gacactctgctgatgtgcattgtcacggtcatgaaccacgggctgcgcaatggaggcggc
gtgggcgacatcctccgcaagccctccaaagacgagtctctcttcccagcccgcgtggtc
tacgacctgctgttcttcttcatcgtcatcatcatcgtgctgaacctcatcttcggcgtg
atcatcgacaccttcgccgacctgcgcagcgagaagcagaagaaggaggagatcctcaag
accacctgcttcatctgcggtctggagagggacaagtttgataacaagacggtgtcgttc
gaggagcacatcaagctggagcacaacatgtggaactacctgtacttcatcgtgctggtc
cgcgtcaagaacaagaccgactacaccggccccgagagctacgtggcccagatgatcaag
aataagaacctggactggttcccccggatgcgagccatgtccctcgtgagcaacgagggt
gagggggaacagaacgagatccgcattctgcaggacaagctcaactccaccatgaagctg
gtgtcccacctcaccgcccagctcaacgagctcaaggagcagatgacggagcagcggaaa
cgcaggcagcgtctgggctttgtggatgtgcagaactgcatgagccgctga

KEGG   Oryctolagus cuniculus (rabbit): 100009505
Entry
100009505         CDS       T03373                                 

Gene name
ITPR1
Definition
(RefSeq) inositol 1,4,5-trisphosphate receptor type 1
  KO
K04958  inositol 1,4,5-triphosphate receptor type 1
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04020  Calcium signaling pathway
ocu04022  cGMP-PKG signaling pathway
ocu04070  Phosphatidylinositol signaling system
ocu04114  Oocyte meiosis
ocu04140  Autophagy - animal
ocu04210  Apoptosis
ocu04218  Cellular senescence
ocu04270  Vascular smooth muscle contraction
ocu04371  Apelin signaling pathway
ocu04540  Gap junction
ocu04611  Platelet activation
ocu04621  NOD-like receptor signaling pathway
ocu04625  C-type lectin receptor signaling pathway
ocu04713  Circadian entrainment
ocu04720  Long-term potentiation
ocu04723  Retrograde endocannabinoid signaling
ocu04724  Glutamatergic synapse
ocu04725  Cholinergic synapse
ocu04726  Serotonergic synapse
ocu04728  Dopaminergic synapse
ocu04730  Long-term depression
ocu04750  Inflammatory mediator regulation of TRP channels
ocu04912  GnRH signaling pathway
ocu04915  Estrogen signaling pathway
ocu04918  Thyroid hormone synthesis
ocu04921  Oxytocin signaling pathway
ocu04922  Glucagon signaling pathway
ocu04924  Renin secretion
ocu04925  Aldosterone synthesis and secretion
ocu04927  Cortisol synthesis and secretion
ocu04928  Parathyroid hormone synthesis, secretion and action
ocu04929  GnRH secretion
ocu04934  Cushing syndrome
ocu04935  Growth hormone synthesis, secretion and action
ocu04970  Salivary secretion
ocu04971  Gastric acid secretion
ocu04972  Pancreatic secretion
ocu05010  Alzheimer disease
ocu05012  Parkinson disease
ocu05016  Huntington disease
ocu05017  Spinocerebellar ataxia
ocu05020  Prion disease
ocu05022  Pathways of neurodegeneration - multiple diseases
ocu05163  Human cytomegalovirus infection
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05170  Human immunodeficiency virus 1 infection
ocu05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100009505 (ITPR1)
   04020 Calcium signaling pathway
    100009505 (ITPR1)
   04070 Phosphatidylinositol signaling system
    100009505 (ITPR1)
   04022 cGMP-PKG signaling pathway
    100009505 (ITPR1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100009505 (ITPR1)
  09143 Cell growth and death
   04114 Oocyte meiosis
    100009505 (ITPR1)
   04210 Apoptosis
    100009505 (ITPR1)
   04218 Cellular senescence
    100009505 (ITPR1)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100009505 (ITPR1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100009505 (ITPR1)
   04621 NOD-like receptor signaling pathway
    100009505 (ITPR1)
   04625 C-type lectin receptor signaling pathway
    100009505 (ITPR1)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    100009505 (ITPR1)
   04929 GnRH secretion
    100009505 (ITPR1)
   04912 GnRH signaling pathway
    100009505 (ITPR1)
   04915 Estrogen signaling pathway
    100009505 (ITPR1)
   04921 Oxytocin signaling pathway
    100009505 (ITPR1)
   04935 Growth hormone synthesis, secretion and action
    100009505 (ITPR1)
   04918 Thyroid hormone synthesis
    100009505 (ITPR1)
   04928 Parathyroid hormone synthesis, secretion and action
    100009505 (ITPR1)
   04924 Renin secretion
    100009505 (ITPR1)
   04925 Aldosterone synthesis and secretion
    100009505 (ITPR1)
   04927 Cortisol synthesis and secretion
    100009505 (ITPR1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100009505 (ITPR1)
  09154 Digestive system
   04970 Salivary secretion
    100009505 (ITPR1)
   04971 Gastric acid secretion
    100009505 (ITPR1)
   04972 Pancreatic secretion
    100009505 (ITPR1)
  09156 Nervous system
   04724 Glutamatergic synapse
    100009505 (ITPR1)
   04725 Cholinergic synapse
    100009505 (ITPR1)
   04728 Dopaminergic synapse
    100009505 (ITPR1)
   04726 Serotonergic synapse
    100009505 (ITPR1)
   04720 Long-term potentiation
    100009505 (ITPR1)
   04730 Long-term depression
    100009505 (ITPR1)
   04723 Retrograde endocannabinoid signaling
    100009505 (ITPR1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100009505 (ITPR1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100009505 (ITPR1)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100009505 (ITPR1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100009505 (ITPR1)
   05012 Parkinson disease
    100009505 (ITPR1)
   05016 Huntington disease
    100009505 (ITPR1)
   05017 Spinocerebellar ataxia
    100009505 (ITPR1)
   05020 Prion disease
    100009505 (ITPR1)
   05022 Pathways of neurodegeneration - multiple diseases
    100009505 (ITPR1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100009505 (ITPR1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100009505 (ITPR1)
   05163 Human cytomegalovirus infection
    100009505 (ITPR1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100009505 (ITPR1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ocu01009]
    100009505 (ITPR1)
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:ocu04040]
    100009505 (ITPR1)
Protein phosphatases and associated proteins [BR:ocu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100009505 (ITPR1)
Ion channels [BR:ocu04040]
 Ligand-gated channels
  IP3 receptor
   100009505 (ITPR1)
SSDB
Motif
Pfam: Ins145_P3_rec RYDR_ITPR MIR RIH_assoc Ion_trans
Other DBs
NCBI-GeneID: 100009505
NCBI-ProteinID: XP_008271817
Ensembl: ENSOCUG00000012148
UniProt: G1T2R2
LinkDB
Position
Un
AA seq 2749 aa
MSDKMSSFLHIGDICSLYAEGSTNGFISTLGLVDDRCVVQPETGDLNNPPKKFRDCLFKL
CPMNRYSAQKQFWKAAKPGANSTTDAVLLNKLHHAADLEKKQNETENRKLLGTVIQYGNV
IQLLHLKSNKYLTVNKRLPALLEKNAMRVTLDEAGNEGSWFYIQPFYKLRSIGDSVVIGD
KVVLNPVNAGQPLHASSHQLVDNPGCNEVNSVNCNTSWKIVLFMKWSDNKDDILKGGDVV
RLFHAEQEKFLTCDEHRKKQHVFLRTTGRQSATSATSSKALWEVEVVQHDPCRGGAGYWN
SLFRFKHLATGHYLAAEVDPDFEEECLECQPPVDPDQDASRSRLRNAPEKMVYSLVSVPE
GNDISSIFELDPTTLRGGDSLVPRNSYVRLRHLCTNTWVHSTNIPIDKEEEKPVMLKIGT
SPVKEDKEAFAIVPVSPAEVRDLDFANDASKVLGSIAGKLEKGTITQNERRSVTKLLEDL
VYFVTGGTNSGQDVLEVVFSKPNRERQKLMREQNILKQIFKLLQAPFTDCGDGPMLRLEE
LGDQRHAPFRHICRLCYRVLRHSQQDYRKNQEYIAKQFGFMQKQIGYDVLAEDTITALLH
NNRKLLEKHITAAEIDTFVSLVRKNREPRFLDYLSDLCVSMNKSIPVTQELICKAVLNPT
NADILIETKLVLSRFEFEGVSSGESALEAGEDEEEVWLFWRDSHKEVRSKSVRELAQDAK
EGQKEDRDVLSYYRYQLNLFARMCLDRQYLAINDISGQLDVDLILRCMSDENLPYDLRAS
FCRLMLHMHVDRDPQEQVTPVKYARLWSEIPSEIAIDDYDSSGTSKDDIKERFSQTMEFV
EEYLRDVVCQRFPFSDKEKNKLTFEVVNLARNLIYFGFYNFSDLLRLTKILLAILDCVHV
TTIFPVSKMAKGEESKGSNVMRSIHGVGELMTQVVLRGGGFLPMTPMATAPEGNVKQAEP
EKEDIMVMDTKLKIIEILQFILNVRLDYRISCLLCIFKREFDESNSQTTEAASGSSSPEG
PSNVPGALDFEHIEEQAEGIFGGSEENTPLDLDDHGGRTFLRVLLHLTMHDYPPLVSGAL
QLLFRHFSQRQEVLQAFKQVQLLVTSQDVDNYKQIKQDLDQLRSIVEKSELWVYKGQGPD
ETMDGASGENEHKKAEEGNNKSQKHESASSYNYRVVKEILIRLSKLCVQESASVRKSRKQ
QQRLLRNMGAHAVVLELLQIPYEKAEDTKMQEIMRLAHEFLQNFCAGNQQNQALLHKHIN
LFLNPGILEAVTMQHIFMNNFQLCSEINERVVQHFVHCIETHGRNVQYIKFLQTIVKAEG
KFIKKCQDMVMAELVNSGEDVLVFYNDRASFQTLIQMMRSERDRMDENSPLMYHIHLVEL
LAVCTEGKNVYTEIKCNSLLPLDDIVRVVTHEDCIPEVKIAYINFLNHCYVDTEVEMKEI
YTSNHMWKLFENFLVDICRACNNTSDRKHADSILEKYVTEIVMSIVTTFFSSPFSDQSTT
LQTRQPVFVQLLQGVFRVYHCNWLMPSQKASVESCIRVLSDVAKSRAIAIPVDLDSQVNN
LFLKSHNIVQKTAMNWRLSARNAARRDSVLAASRDYRNIIERLQDIVSALEDRLRPLVQA
ELSVLVDVLHRPELLFPENTDARRKCESGGFICKLIKHTKQLLEENEEKLCIKVLQTLRE
MMTKDRGYGDKQISIDEVDNAELPPTPDSDNSTEQELEPSPPLRQLEDHKRGEALRQILV
NRYYGNVRPSGRRESLTSFGNGPLSPGAPSKPGGGGGGSGSSSVSRGDMSLAEVQCHLDK
EGASNLVIDLIMNASSDRVFHESILLAIALLEGGNTTIQHSFFCRLTEDKKSEKFFKVFY
DRMKVAQQEIKATVTVNTSDLGNKKKDDEVDRDAPSRKKAKEPSTQITEEVRDQLLEASA
ATRKAFSTFRREADPDDHYQPGEGAQATADKTKDELEMSAVITIMQPILRFLQLLCENHN
RDLQNFLRCQSNKTNYNLVCETLQFLDCICGSTTGGLGLLGLYINEKNVALINQTLESLT
EYCQGPCHENQNCIATHESNGIDIITALILNDINPLGKKRMDLVLELKNNASKLLLAIME
SRHDSENAERILYNMRPKELVEVIKKAYMQGEVEFEDGENGEDGAASPRNVGHNIYILAH
QLARHNKELQSMLKPGGQVDGDEALEFYAKHTAQIEIVRLDRTMEQIVFPVPSICEFLTK
ESKLRIYYTTERDEQGSKINDFFLRSEDLFNEMNWQKKLRAQPVLYWCARNMSFWSSISF
NLAVLMNLLVAFFYPFRGVRGGTLEPHWSGLLWTAMLLSLAIVIALPKPHGIRALIASTI
LRLIFSVGLQPTLFLLGAFNVCNKIIFLMSFVGNCGTFTRGYRAMVLDVEFLYHLLYLLI
CAMGLFVHEFFYSLLLFDLVYREETLLNVIKSVTRNGRSIILTAVLALILVYLFSIVGYL
FFKDDFILEVDRLPNETALPESGESLASDFLYSDMCRVETGGNCSSLEPGEELIPVGETE
QDEEHTCETLLMCIVTVLSHGLRSGGGVGDVLRKPSKEEPLFAARVIYDLLFFFMVIIIV
LNLIFGVIIDTFADLRSEKQKKEEILKTTCFICGLERDKFDNKTVTFEEHIKEEHNMWHY
LCFIVLVKVKDSTEYTGPESYVAEMIKERNLDWFPRMRAMSLVSSDSEGEQNELRSLQEK
LESTMRLVSNLSGQLSELKDQMTEQRKQKQRIGLLGHPPHMNVNPQQPA
NT seq 8250 nt   +upstreamnt  +downstreamnt
atgtctgacaaaatgtctagtttcctgcacatcggagacatttgttctctgtacgcagag
ggatcaacaaatggattcattagcaccttgggcctggttgacgatcggtgtgtggtgcag
ccagaaaccggggaccttaacaacccacctaagaaattcagagactgcctcttcaagcta
tgccccatgaaccgctactcggcccagaagcagttctggaaagcagccaagcccggcgcc
aacagcaccaccgacgcagtgctgctcaacaagttgcaccacgctgcagacttggaaaag
aaacagaatgagacagaaaacaggaagctgctggggaccgtgatccagtatggcaacgtc
atccagctcctgcacctgaagagcaataaatacctgacagtgaacaagaggctcccggca
ctgctggagaagaacgccatgcgggtgacgctggacgaggcggggaacgaaggctcctgg
ttctacatccagcccttctacaagctgcgctccatcggagacagcgtggtcatcggggac
aaggttgtgctgaaccctgtcaatgctggtcagcccctgcatgccagcagccaccagctc
gtggacaacccaggctgcaacgaggtcaactccgtcaactgcaacacgagctggaaaatc
gtgcttttcatgaaatggagcgacaacaaggatgacatcctgaaggggggcgacgtggtg
aggctgttccatgccgagcaggagaagtttctcacctgtgacgagcaccgcaagaagcag
catgtgttcctgaggaccactggccgccagtcggccacgtcggccaccagctccaaggcc
ctgtgggaggtagaggttgtccagcatgacccgtgtcggggcggcgccggttactggaac
agcctcttccgtttcaagcatctggccacggggcattacttagcagcagaggtagaccct
gactttgaggaagaatgcctggagtgtcagcccccagtggaccctgaccaggatgcctct
agaagcaggctgcggaatgccccggaaaagatggtctactcactggtctctgtgcctgaa
ggcaatgacatctcctccatctttgagctggaccccaccaccctccggggaggcgacagc
ctggtcccaaggaactcctatgtccgactcagacacttgtgcaccaatacctgggttcac
agcaccaacatccccattgacaaggaggaggaaaagccggtgatgctgaaaatcggcacc
tcccctgtgaaggaggacaaggaagcgtttgccattgttcctgtttctcctgcggaagtg
cgagacctggacttcgcaaatgacgccagcaaggtgctgggctccatcgctgggaagctg
gagaagggcaccatcacccagaatgagcgccggtctgtcaccaagctgctggaagacctg
gtttactttgtcaccggaggaaccaactctggccaagatgtccttgaagtggtcttctct
aagcccaacagagagcggcagaagctgatgcgagaacagaacatcctcaagcagatcttc
aagttgctgcaggcacccttcaccgactgtggcgacggccccatgctgcgtctggaggag
ctgggggaccagcggcatgcacccttccggcacatctgccgcctgtgctaccgcgtcctg
cggcactcgcagcaggattacaggaagaaccaggagtacatcgccaagcagttcggcttc
atgcagaagcagatcggctacgatgtgctggccgaggacaccatcactgccctgctgcac
aacaaccgcaagctgctggagaagcacatcaccgcggccgagatcgacaccttcgtcagt
ctggtgcgcaagaaccgggagcccaggttcctcgattacctctctgacctctgtgtgtcc
atgaacaaatccatcccagtgacccaggaactgatctgcaaggctgtactgaaccctacc
aacgctgacatcctcatcgagaccaagctggttctttctcgtttcgagtttgaaggggtg
tctagcggagagagcgccctggaggctggcgaggacgaggaggaggtgtggctgttctgg
agagacagccacaaagaggtgcgcagcaagagcgtgcgggagctggcccaggacgccaaa
gagggacagaaggaagaccgagatgtcctcagctactaccggtaccagctgaacctcttc
gctaggatgtgtctggaccgccagtacctggccatcaacgacatctcgggccagctggac
gtggacctcatcctgcgctgcatgtcggacgagaacctgccctacgacctgcgggcatcc
ttctgccgcctcatgctgcacatgcatgtggaccgagacccgcaggagcaggtcacgcct
gtgaagtacgcccgcctctggtcagagatcccctcggagatcgccatcgacgactatgat
agcagtgggacttccaaagatgacatcaaggagaggttctcccagaccatggagttcgtg
gaggagtacctgcgagacgtggtttgccagaggttcccattctctgataaggagaaaaac
aagctcacctttgaggttgtgaatttagctaggaacctcatatacttcgggttctacaat
ttctccgacctcctgcggttaaccaagatcctcctggccatattagactgtgtgcacgtg
acgaccatcttccctgtcagcaagatggccaagggagaggagagcaaaggcagcaacgtg
atgaggtccatccacggggttggggagctgatgacccaggtggtgctccggggtgggggc
tttctgcctatgacccccatggccaccgcacctgagggcaacgtgaagcaggcggagccc
gagaaggaggacatcatggtcatggacaccaagctgaagatcatcgagatcctgcagttc
attttgaacgtgaggttggattaccgcatctcctgcctcctgtgcatattcaagcgggag
tttgacgaaagcaactcccagacgacagaagcagcatccggaagcagcagccctgaaggg
cccagtaatgtcccaggtgctctcgacttcgaacacatcgaggagcaagcagaaggcatc
tttggaggaagtgaggagaacacgccgctggacctggatgaccacggcggcaggaccttc
ttgcgcgtgctgctgcacttgaccatgcacgactacccgcccctggtgtcgggggccctg
cagctgctcttccggcacttcagtcagaggcaggaggtcctacaggccttcaagcaggtc
cagctgctggtgaccagccaggatgtggacaactacaaacagatcaagcaggacctggat
cagctgaggtccatcgtggagaagtcggagctctgggtgtacaaggggcaggggcccgat
gagaccatggacggtgcttctggagaaaatgaacacaagaaagcagaggaggggaacaac
aagtcgcagaagcacgagagcgccagcagctacaactacagggtggtcaaggagatcttg
attcggctcagcaaactctgcgtgcaggagagcgcctcagtgaggaagagcaggaagcag
cagcagcgactgctgcggaacatgggcgcgcacgccgtggtgctggagctgctgcagatc
ccctacgagaaggctgaggataccaagatgcaagagatcatgaggctggctcatgaattt
ttgcagaatttctgtgcaggcaaccagcagaatcaagccttgctgcataaacacatcaac
ctgtttctcaaccctgggatcctcgaggccgtgacgatgcagcacatcttcatgaacaac
ttccagctgtgcagtgagatcaacgagagagttgtccagcacttcgttcactgcatagag
acccacggccgcaacgtccagtatataaagttcctgcagactatcgtcaaggcagaaggg
aaatttattaaaaagtgccaagacatggtcatggccgagctggtcaactccggagaggat
gtccttgtgttctacaacgacagagcatctttccagacgctgatccagatgatgaggtcg
gagcgtgaccgcatggacgagaacagcccactcatgtaccacatccacctggtggagctc
ctggccgtgtgcaccgaaggcaagaacgtttacacggagatcaagtgcaactccctgctc
ccgctggacgatatcgtccgcgtggtcacccatgaggactgcattcccgaggtgaaaatc
gcatacataaacttcctgaaccactgctacgtggacaccgaggtggagatgaaggagatc
tacaccagcaaccacatgtggaagctctttgagaatttcctggtggacatctgcagggcc
tgtaacaacacaagcgacaggaagcacgcggactcgatcctggagaagtacgttactgaa
attgtcatgagcattgtcacgaccttcttcagttctcccttctcggaccagagcacaact
ctgcagactcgccagcccgtctttgtgcagctgctgcagggtgtattcagagtttaccac
tgcaactggctgatgccaagccagaaggcgtctgtagagagctgcatccgggtgctgtct
gacgtggccaagagccgggccattgccattcctgtggacctggacagccaagtcaacaac
ctcttcctgaagtcccacaacatcgtgcagaaaacagccatgaactggcgtctgtccgcc
cgcaatgctgcccgcagggactcggtcctggcggcttccagagactaccggaatatcatt
gagagactgcaggacatcgtctcggcgctggaggaccggctccggcccctggtccaggca
gagctgtctgtgctcgtggatgtcctgcatagacccgagctgctcttcccggagaacacg
gatgccaggaggaagtgtgaaagtggcggcttcatttgcaagttaatcaagcacaccaag
cagctgctggaagagaacgaggagaagctgtgcattaaagtcttgcagaccctccgggaa
atgatgaccaaggacagaggctacggggacaagcaaatttccattgatgaagtggacaat
gccgagctgccaccaactccggattccgacaactccacagagcaggagcttgaaccaagt
ccacccctgaggcaactggaagaccataaaaggggtgaggcgctcaggcaaattttggtc
aaccgttactatggaaacgtcagaccttcgggaagaagagagagcctgaccagctttggc
aatggcccgctgtcaccaggagcccccagcaagcctgggggaggaggaggaggttccgga
tccagctccgtgagcaggggtgacatgagcctggccgaggttcagtgccaccttgacaag
gagggggcctccaatctggtgatcgacctgatcatgaatgcctccagcgaccgggtcttc
cacgagagcattctcctggccatcgcccttctggagggaggcaacaccaccatccagcat
tcttttttctgccggttgactgaagataagaagtcggagaagttcttcaaggtcttttac
gacaggatgaaagtggcccagcaggaaatcaaggcgactgtgacggtgaacaccagtgac
ctggggaacaagaagaaagacgacgaggtggacagggatgccccgtctcggaagaaagcc
aaggagccctcaacccagatcacggaggaggtgcgggatcagctcttggaggcgtccgct
gccaccaggaaggccttctccacgttcaggagggaggctgacccagacgaccactatcag
ccgggcgagggcgcacaggccacggccgacaagaccaaggatgagctggagatgagcgct
gtcatcaccatcatgcagcccatcctccgcttcctgcagctgctgtgtgaaaaccacaac
cgagacctgcagaacttcctccgttgccagagcaacaagaccaactacaatctggtgtgc
gagaccctgcagttcctggactgcatctgcggaagcactacgggaggtctggggctcctc
ggcctgtacatcaacgagaagaacgtggccctcatcaaccagaccctggagagtctgacc
gagtactgccaggggccgtgccacgagaaccagaactgcatcgccacccatgagtccaat
ggcatcgacatcatcaccgccctcatcctcaacgacatcaaccctctggggaagaagagg
atggacctggtgctggagctgaagaacaacgcttccaagctgctcctggccatcatggag
agcaggcatgacagcgagaacgccgagaggatcctttacaacatgcggcccaaggagctg
gtggaggtgatcaagaaggcctacatgcaaggcgaagtggaatttgaagacggagagaac
ggcgaggatggggccgcctccccaaggaacgtggggcacaacatctacatcctggctcat
cagttggcgcgacacaacaaggaactgcagagcatgctgaagcctggcggccaggtggac
ggcgatgaggcgctggagttttacgccaagcacacggcacagatagagatcgtgcggctg
gaccgaaccatggagcagatcgtgttccccgtgcccagcatctgcgagttcctgaccaag
gagtcgaagctgcgcatctactacaccaccgagagagacgagcagggcagcaagatcaac
gacttcttcctgcgctccgaggacctcttcaacgagatgaactggcagaagaagctcaga
gcccagcccgtgctgtactggtgtgcacgcaacatgtccttctggagcagcatctccttc
aacctggccgtgctcatgaacctgctggtggccttcttctacccgttcagaggcgtgcga
ggaggaacgctggagccgcactggtcgggcctcctgtggacggccatgctcctgtccctg
gccatcgtcatcgccctccccaagccccacggcatccgcgccttaatcgcctccacaatc
ctacggctgatattctcggtcgggctgcagcccacgttgtttctgctgggagccttcaac
gtctgcaacaaaatcatctttctcatgagctttgtgggcaactgtggcacgttcacaaga
ggctaccgcgccatggtgctggacgtggagttcctgtaccacctgttgtacctgctcatc
tgtgccatggggctctttgtgcacgaattcttctacagcctgctgctctttgatttagta
tacagagaagagactttgctcaacgtcatcaagagtgtcacccgcaatggccgctccatc
attctgacggcagtgctggctctgatcctggtctacctgttctccattgtgggctacctc
ttcttcaaggatgacttcatcctggaggtagacaggttgcccaacgagacagctctccca
gagtccggtgagagcctggcgagcgacttcctgtactctgacatgtgtcgggtggagaca
gggggcaattgctcctccctggagcccggggaagagctcatccccgtcggggagacggag
caggacgaggagcacacgtgcgagacgctgctgatgtgcatcgtcactgtgctgagccac
gggctgcggagtgggggcggcgtgggcgacgtgctcaggaagccgtccaaagaggagccc
ctctttgccgcgagagtgatctacgacctcctgttcttcttcatggtcatcatcatcgtc
ctcaacctgattttcggggtcatcattgacacctttgccgacctgaggagcgagaagcag
aagaaagaggagatcttgaagaccacctgcttcatctgcggcctggaaagagacaagttt
gacaataagacggtcactttcgaggagcacatcaaagaggagcacaacatgtggcactac
ctgtgcttcatcgtcctggtgaaggtgaaggactccaccgagtacacggggcccgagagc
tacgtggccgagatgatcaaggaacgcaacctcgactggttcccacggatgcgagccatg
tccctggtcagcagcgactcggagggcgagcagaacgagctgcgcagcctgcaggagaag
ctggagtccaccatgagactggtcagcaacctctcggggcagctgtcggagctcaaagac
cagatgacagaacagaggaagcagaaacaaagaatcggtcttctaggacatcctccgcac
atgaacgtcaacccgcagcagccggcctga

KEGG   Oryctolagus cuniculus (rabbit): 100356806
Entry
100356806         CDS       T03373                                 

Gene name
ITPR2
Definition
(RefSeq) inositol 1,4,5-trisphosphate receptor type 2
  KO
K04959  inositol 1,4,5-triphosphate receptor type 2
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04020  Calcium signaling pathway
ocu04022  cGMP-PKG signaling pathway
ocu04070  Phosphatidylinositol signaling system
ocu04114  Oocyte meiosis
ocu04210  Apoptosis
ocu04218  Cellular senescence
ocu04270  Vascular smooth muscle contraction
ocu04371  Apelin signaling pathway
ocu04540  Gap junction
ocu04611  Platelet activation
ocu04621  NOD-like receptor signaling pathway
ocu04625  C-type lectin receptor signaling pathway
ocu04720  Long-term potentiation
ocu04723  Retrograde endocannabinoid signaling
ocu04724  Glutamatergic synapse
ocu04725  Cholinergic synapse
ocu04726  Serotonergic synapse
ocu04728  Dopaminergic synapse
ocu04730  Long-term depression
ocu04750  Inflammatory mediator regulation of TRP channels
ocu04912  GnRH signaling pathway
ocu04915  Estrogen signaling pathway
ocu04918  Thyroid hormone synthesis
ocu04921  Oxytocin signaling pathway
ocu04922  Glucagon signaling pathway
ocu04924  Renin secretion
ocu04925  Aldosterone synthesis and secretion
ocu04927  Cortisol synthesis and secretion
ocu04928  Parathyroid hormone synthesis, secretion and action
ocu04929  GnRH secretion
ocu04934  Cushing syndrome
ocu04935  Growth hormone synthesis, secretion and action
ocu04970  Salivary secretion
ocu04971  Gastric acid secretion
ocu04972  Pancreatic secretion
ocu05010  Alzheimer disease
ocu05012  Parkinson disease
ocu05017  Spinocerebellar ataxia
ocu05020  Prion disease
ocu05022  Pathways of neurodegeneration - multiple diseases
ocu05163  Human cytomegalovirus infection
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05170  Human immunodeficiency virus 1 infection
ocu05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100356806 (ITPR2)
   04020 Calcium signaling pathway
    100356806 (ITPR2)
   04070 Phosphatidylinositol signaling system
    100356806 (ITPR2)
   04022 cGMP-PKG signaling pathway
    100356806 (ITPR2)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100356806 (ITPR2)
   04210 Apoptosis
    100356806 (ITPR2)
   04218 Cellular senescence
    100356806 (ITPR2)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100356806 (ITPR2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100356806 (ITPR2)
   04621 NOD-like receptor signaling pathway
    100356806 (ITPR2)
   04625 C-type lectin receptor signaling pathway
    100356806 (ITPR2)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    100356806 (ITPR2)
   04929 GnRH secretion
    100356806 (ITPR2)
   04912 GnRH signaling pathway
    100356806 (ITPR2)
   04915 Estrogen signaling pathway
    100356806 (ITPR2)
   04921 Oxytocin signaling pathway
    100356806 (ITPR2)
   04935 Growth hormone synthesis, secretion and action
    100356806 (ITPR2)
   04918 Thyroid hormone synthesis
    100356806 (ITPR2)
   04928 Parathyroid hormone synthesis, secretion and action
    100356806 (ITPR2)
   04924 Renin secretion
    100356806 (ITPR2)
   04925 Aldosterone synthesis and secretion
    100356806 (ITPR2)
   04927 Cortisol synthesis and secretion
    100356806 (ITPR2)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100356806 (ITPR2)
  09154 Digestive system
   04970 Salivary secretion
    100356806 (ITPR2)
   04971 Gastric acid secretion
    100356806 (ITPR2)
   04972 Pancreatic secretion
    100356806 (ITPR2)
  09156 Nervous system
   04724 Glutamatergic synapse
    100356806 (ITPR2)
   04725 Cholinergic synapse
    100356806 (ITPR2)
   04728 Dopaminergic synapse
    100356806 (ITPR2)
   04726 Serotonergic synapse
    100356806 (ITPR2)
   04720 Long-term potentiation
    100356806 (ITPR2)
   04730 Long-term depression
    100356806 (ITPR2)
   04723 Retrograde endocannabinoid signaling
    100356806 (ITPR2)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100356806 (ITPR2)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100356806 (ITPR2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100356806 (ITPR2)
   05012 Parkinson disease
    100356806 (ITPR2)
   05017 Spinocerebellar ataxia
    100356806 (ITPR2)
   05020 Prion disease
    100356806 (ITPR2)
   05022 Pathways of neurodegeneration - multiple diseases
    100356806 (ITPR2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100356806 (ITPR2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100356806 (ITPR2)
   05163 Human cytomegalovirus infection
    100356806 (ITPR2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100356806 (ITPR2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:ocu04040]
    100356806 (ITPR2)
Ion channels [BR:ocu04040]
 Ligand-gated channels
  IP3 receptor
   100356806 (ITPR2)
SSDB
Motif
Pfam: Ins145_P3_rec RYDR_ITPR MIR RIH_assoc Ion_trans DUF2207 Sec2p
Other DBs
NCBI-GeneID: 100356806
NCBI-ProteinID: XP_008257723
Ensembl: ENSOCUG00000010741
LinkDB
Position
8
AA seq 2701 aa
MSDKMSSFLYIGDIVSLYAEGSVNGFISTLGLVDDRCVVHPEAGDLANPPKKFRDCLFKV
CPMNRYSAQKQYWKAKQAKQGNHTEAALLKKLQHAAELEQKQNESENKKLLGEIVKYSNV
IQLLHIKSNKYLTVNKRLPALLEKNAMRVSLDAAGNEGSWFYIHPFWKLRSEGDNIVVGD
KVVLMPVNAGQPLHASNIELLDNPGCKEVNAVNCNTSWKITLFMKFSSYREDVLKGGDVV
RLFHAEQEKFLTCDEYEKKQHIFLRTTLRQSATSATSSKALWEIEVVHHDPCRGGAGQWN
SLFRFKHLATGNYLAAELNPDYRDAQSEGKNAREGDLPTSKKKRQVGEKIMYTLVSVPHG
NDIASLFELDATTLQRADCLVPRNSYVRLRHLCTNTWVTSTSIPIDTDEERPVMLKIGTC
QTKEDKEAFAIVSVPLSEVRDLDFANDANKVLATTVKKLENGTITQNERRFVTKLLEDLI
FFVADVPNNGQEVLDVVITKPNRERQKLMREQNILAQVFGILKAPFKEKAGEGSMLRLED
LGDQRYAPYKYMLRLCYRVLRHSQQDYRKNQEYIAKNFCVMQSQIGYDILAEDTITALLH
NNRKLLEKHITAKEIETFVSLLRRNREPRFLDYLSDLCVSNTTAIPVTQELICKFMLSPG
NADILIQTKLVSMQIDNPMESSILPDDIDDEEVWLYWIDSNKEPHGKAIRHLAQEAKEGT
KADLEVLTYYRYQLNLFARMCLDRQYLAINQISTQLSVDLILRCVSDESLPFDLRASFCR
LMLHMHVDRDPQESVVPVRYARLWTEIPTKITIHEYDSITDSSRNDMKRKFALTMEFVEE
YLKEVVNQPFPFGDKEKNKLTFEVVHLARNLIYFGFYSFSELLRLTRTLLAILDIVQAPM
SSYFERLSKFQDGGNNVMRTIHGVGEMMTQMVLSRGSIFPMSVPDTQPSVHPSKQASPTE
QEDVTVMDTKLKIIEILQFILSVRLDYRISYMLSIYKKEFGENSENAEVSATGSPETLLP
SALVPDIEEIAAQAETMFAGRKEKNPVQLDDEGGRTFLRVLIHLIMHEYPPLLSGALQLL
FKHFSQRAEVLQAFRQVQLLVSNQDVDNYKQIKADLDQLRLTVEKSELWVEKSSSYESGE
AGESQVKGGEEPMEESNILSPVQDGTKKPQIDSNKRNNYRVVKEILIRLSKLCVQNKKCR
NQHQRLLKNMGAHSVVLDLLQIPYEKNDEKMNEVMTLAHTFLQNFCRGNPQNQVLLHKHL
HLFLTPGLLEAETMRHIFMNNYHLCNEISERVVQHFVHCIETHGRHVEYLRFLQTIVKAD
GKYVKKCQDMVMTELINGGEDVLIFYNDRASFPSLLHMMCSERDRGDDSGPLAYHITLVE
LLAACTEGKNVYTEIKCNSLLPLDDIVRVVTHDDCIPEVKIAYVNFVNHCYVDTEVEMKE
IYTSNHIWKLFENFLVDMARVCNTTTDRKHADTFLEKCVTESIMSIVSGFFNSPFSDSST
SLQTHQPVFIQLLQSAFRIYNCTWPNPAQKASVESCIRTLAEVAKNRGIAIPVDLDSQVN
TLFMKSHSNMVQRAAMGWRLSARSGPRFKEALGGPAWDYRNIIEKLQDVVASLEQQLSPM
MQAEFSVLVDVLYSPELLFPEGSDARIRCGAFMSKLINHTKKLMEKEEKLCIKILKTLRE
MLEKKDSFVEEGNTLRKILLNRYFKGDYGIGMNGHLSGTYSRSAQVGGSFSAQDTDKMGI
SMADIQCLLDKEGASELVIDVIVNTKNDRIFSEGILLGIALLEGGNTQTQYSFYQQLHEQ
KKSEKFFKVLYDRMKAAQKEIRSTVTVNTIDLGSKKRDDDNEAMTSGPRMRVRDSSLHLK
EGMKGQLTEASSATSKAYCVYRREMDPELDMVCSGPEAGSAEDRSAEEVPMSPAIAIMQP
ILRFLQLLCENHNRELQNFLRNQNNKTNYNLVCETLQFLDCICGSTTGGLGLLGLYINEK
NVALVNQTLESLTEYCQGPCHENQTCIATHESNGIDIIIALILNDINPLGKYRMDLVLQL
KNNASKLLLAIMESRHDSENAERILFNMRPRELVDVMKNAYNQGVECDRGDDEGGDDGVS
PKDVGHNIYILAHQLARHNKLLQHMLKPGLDPEEGDEALKYYANHTAQIEIVRHDRTMEQ
IVFPVPNICEYLTRESKCRVYNTTERDEQGSKVNDFFQQTEDLYNEMKWQKKIRSNPALF
WFSRHISLWGSISFNLAVFINLAVALFYPFGDDGDEGTLSPLFSILLWIAVAICTSMLFF
FSKPVGIRPFLVSIMLRSIYTIGLGPTLILLGAANLCNKIVFLVSFVGNRGTFTRGYRAV
ILDVAFLYHVAYVLVCMLGLFIHEFFYSFLLFDLVYREETLLNVIKSVTRNGRSIILTAV
LALILVYLFSIIGFLFLKDDFTMEVDRLKNRTPVTGNYEVPTTTLSSMTETCDKNNCSAT
IPASSTAGEEYEDGIERTCDTLLMCIVTVLNQGLRNGGGVGDVLRRPSKDEPLFAARVVY
DLLFFFIVIIIVLNLIFGVIIDTFADLRSEKQKKEEILKTTCFICGLERDKFDNKTVSFE
EHIKSEHNMWHYLYFIVLVKVKDPTEYTGPESYVAQMIVEKNLDWFPRMRAMSLVSNEGD
SEQNEIRSLQEKLESTMSLVRQLSGQLAELKEQMTEQRKNKQRLGFLGSNTAHVNHHMPP
H
NT seq 8106 nt   +upstreamnt  +downstreamnt
atgtccgataagatgtccagcttcctctacatcggggacatcgtgtccctgtacgccgag
ggctcggtcaacggcttcatcagcaccctggggttagtggatgacagatgtgtggtacac
ccagaggccggggaccttgccaaccctcccaagaagttcagggactgcctcttcaaggtg
tgccctatgaatcggtactctgcccagaagcagtattggaaagccaagcaggcaaaacaa
gggaaccacacggaggctgcgctgctgaagaagctgcagcatgctgcagaactggaacaa
aagcaaaatgaatcagagaataagaagctgttgggagaaattgtgaaatacagtaatgtc
atacaactactgcatataaaaagcaacaagtatctgaccgtcaacaagagattacctgct
ttgctggagaagaacgccatgcgtgtgtccctggatgctgccggaaacgaggggtcctgg
ttctacattcaccccttctggaagctgagaagtgagggggacaatatcgttgtgggagac
aaagttgttctgatgcctgtgaacgcgggacagccactccacgccagcaacatagaactg
ctcgacaaccccgggtgcaaagaggtgaatgctgttaattgcaacactagttggaaaatc
acgttgttcatgaaatttagttcctaccgcgaggatgtattaaaaggaggtgacgttgtt
agattgttccatgcggaacaagagaaatttctgacttgcgatgaatacgagaagaagcag
catattttccttcggacaaccttgcgccagtcagccacgtctgccacgagttccaaagca
ctctgggaaattgaggtggttcatcatgacccgtgccgtgggggtgcaggacagtggaac
agcctgttcagatttaagcatcttgccactgggaactacttagctgcagagcttaatcct
gattaccgagatgcccaaagtgaaggaaaaaatgcgagagaaggagacctcccaacctca
aagaagaagcgccaggtgggggagaagatcatgtacactttggtctcagtcccgcatgga
aatgacattgcgtcccttttcgaactggatgccacaactctgcagagagctgactgcctg
gttccaaggaactcgtatgttcggttaaggcatttgtgcaccaacacatgggtaaccagt
actagcatccctatagacacagatgaagagaggcctgttatgttgaagatcggaacctgc
caaacaaaagaagacaaagaagcatttgccatcgtgtctgtcccgctgtcggaggtccga
gacttagactttgccaatgatgccaataaggtgctagcaaccacggtgaagaagctggaa
aatggcacaatcacgcagaatgaaaggaggtttgtcaccaaattattggaagacctcatc
ttctttgttgctgacgtgcctaataatggacaagaagttctggacgtggttatcacgaag
ccaaaccgagaacgtcagaaactaatgagggaacagaacatactggcacaggtatttgga
atccttaaagcaccctttaaggagaaagcgggagaaggctcgatgctgagactggaagat
ctaggggaccaaagatacgccccctacaagtacatgctgcggctgtgctaccgcgtcctc
cggcactcccagcaggactaccggaaaaatcaggaatacattgctaagaatttctgtgtc
atgcagtcccagattggctatgatattttggcagaagatacgatcacagctttgttgcac
aacaacagaaaacttctagagaaacatatcacagccaaagaaatagaaacatttgtcagc
ttactcaggagaaaccgagagccaagatttttggattatttgtctgatctctgtgtgtct
aataccactgctatccctgtgactcaggaactcatctgtaaatttatgctgagtccaggc
aatgcagacattctcattcaaaccaagttggtctctatgcaaatagacaaccccatggag
agctccatccttccagatgacattgatgatgaagaagtgtggctctactggattgacagc
aacaaggagcctcacggcaaagccatccggcaccttgctcaagaagcaaaagaaggcacc
aaagctgatttagaagttcttacctattacagatatcagctaaacctctttgcaaggatg
tgcttggatcgccagtatctggccatcaaccagatttctacacagctgtctgtagacttg
atcctgcggtgtgtgtcggatgagagcctgcccttcgacctccgtgcgtctttctgtcgc
ctcatgctgcatatgcacgtggaccgggacccccaggagtccgtggttcctgttcgctat
gccaggctctggacagaaatccccaccaagatcaccattcatgagtacgattctataaca
gattcttccaggaatgatatgaagaggaaatttgcgctgacaatggaatttgttgaagaa
tacttgaaagaagttgtcaatcagccctttccttttggagataaagaaaaaaacaaactg
acatttgaggtggtccacttggctcggaatctcatatacttcggattttatagtttcagt
gagttattaaggctcacacgaacgcttctggccatccttgatattgtgcaggcccctatg
tcatcgtattttgaaagattaagcaaatttcaagatggagggaacaacgtcatgagaact
atccacggggtgggagagatgatgacgcagatggtgctcagcaggggctccatcttccct
atgagtgtgcccgacacgcagcccagtgtccaccccagcaagcaggcaagccccactgag
caggaggacgtgaccgtgatggacaccaagctcaagatcattgagattctacagttcatc
ctgagcgtcagactggactacaggatctcctacatgctgtctatctataagaaggagttt
ggcgagaacagcgagaacgcagaggtgtctgccactggctctccggagaccttgctgccg
tcagctcttgttcctgatatagaggaaatcgcagctcaggcagagaccatgtttgctgga
agaaaggagaagaatcccgttcagcttgatgatgagggagggaggacgttcctccgggtc
ctcattcacctgatcatgcacgagtacccgcccttgctgtccggagccctgcagctgctg
ttcaagcacttcagccagagagccgaggttttacaggccttcagacaggtgcaactactg
gtgtccaatcaagatgtggataactacaagcaaatcaaggcagatctggaccagctgcgg
ctgaccgtggagaagtctgagctgtgggtagagaagagcagcagctacgagagtggggaa
gccggcgagagccaagtgaaaggcggtgaagagccgatggaggagtcaaacattttaagc
ccggtgcaggatggaacaaagaaacctcagattgacagcaataagcgcaacaactaccga
gttgttaaggagattttgattaggctaagtaaactgtgtgtgcagaataaaaagtgtcgg
aatcagcatcagcgattactgaaaaacatgggggctcactcggtggtgctggatctcctg
cagataccctatgaaaagaatgatgagaagatgaacgaagtcatgactctggcccacacc
ttcctgcagaatttctgccgaggaaatccacagaatcaagttcttcttcataaacacctg
catttgtttttaactcctggcctccttgaagcggaaaccatgcggcacatcttcatgaac
aattaccatctgtgcaatgaaatcagcgagagagtcgtgcagcattttgtgcactgcatt
gagacacatggccgccacgtggagtacctgaggttcttgcagaccattgtgaaagcagac
ggcaaatatgtgaagaaatgccaggacatggtaatgacagagctgatcaacggcggtgaa
gatgtgctgatattctacaacgacagagcatcgtttcccagccttctccacatgatgtgt
tccgagagagaccgaggggatgacagcggccccttagcctaccacatcacacttgtggag
ttgctggcggcgtgcacggaggggaagaacgtgtacacggaaatcaagtgtaactccctg
ctgcccctggacgacatagtcagggtggtgacccacgatgactgcatccctgaggttaaa
attgcctatgtgaattttgttaatcactgttacgttgacactgaagtggaaatgaaagaa
atctacaccagcaaccacatttggaaattattcgagaacttcttggtggatatggcaagg
gtttgcaacacaacgacagacaggaaacatgcagacaccttcctggagaagtgtgtgacc
gagtccatcatgagcatcgtgagcggcttcttcaattctccgttttcagacagcagtacc
agcctgcagacacaccagcccgtcttcattcagctgctgcagtctgcattcagaatttac
aactgcacctggccaaacccggcccagaaagcctccgtggaatcctgtatccgaactttg
gctgaagtggcaaaaaatcgtggcattgccattccggtggatttggacagtcaggtcaac
actctgttcatgaagagccactccaatatggtgcagagagcagccatgggctggagactg
tcggctcgctctggaccacgctttaaggaagctcttggagggcctgcttgggactacaga
aatattattgagaagttacaggacgtggtggcctccttggagcagcagttgagccccatg
atgcaggctgagttctctgtgctggttgacgtgctctacagtccggagctgctgttcccc
gagggaagtgatgcgagaatcagatgcggtgctttcatgtccaagttgattaatcatacg
aagaagctgatggagaaagaagaaaaactgtgcattaagatccttaagacactacgagaa
atgctagagaagaaagacagctttgtggaagagggtaatacattaagaaaaatactgctg
aatcgatactttaaaggtgattatggcattggtatgaatggccacttgtcaggaacctac
tccagatctgcacaagtgggaggaagcttttctgcacaagatacagataagatgggaatc
tcaatggctgacattcaatgcctactggataaagaaggggcatctgaacttgtcatcgat
gtcatagtgaacaccaaaaatgataggattttttcagaaggcattttacttggcattgct
ttgctcgaaggaggaaatacacaaacacagtattctttctaccagcagttgcatgaacaa
aagaagtcagaaaaattcttcaaggttctctacgatcgaatgaaagccgctcagaaagag
atacgatccacagtgactgtgaataccatagatttaggtagcaaaaaaagggatgatgat
aacgaggcgatgacatctggaccacgcatgagagtaagagattcgtcgttgcatttaaaa
gagggaatgaaagggcagctgacagaagcttcctcggccacatccaaagcgtactgtgtg
tacagaagagaaatggatccggagctggacatggtgtgctcggggccagaggcaggaagt
gccgaggacaggtctgcagaggaggtgcccatgagcccggccattgccatcatgcagccc
atcctgagattcctgcagctgctgtgtgagaaccacaaccgggagctgcagaacttcttg
aggaatcaaaacaacaaaacaaattacaaccttgtgtgtgagacgcttcagtttttggac
tgcatttgtggaagtacaaccggcggcctgggcctgctaggtctctacatcaatgagaag
aacgttgcgctggtcaaccagaccctggagagtttgactgagtactgccagggcccgtgc
catgagaaccagacatgtattgctacacatgaatcgaatggaattgacatcatcattgct
ttgatcctaaatgacataaaccctcttggtaaataccgaatggacctggtgctccagcta
aagaacaacgcctccaagctgctgctggccatcatggaaagcagacacgacagtgagaac
gcagaaaggatcctgttcaacatgagacccagggagctggtggatgtgatgaagaatgcc
tataaccaaggagtggagtgcgatcgcggcgacgacgagggtggggatgatggcgtttcc
ccaaaagatgttggacacaatatctatatcctggcccatcagctggcccggcacaataaa
ctgttacagcacatgctcaaaccaggactggatcccgaggaaggagatgaagccttgaag
tattatgccaaccacactgctcagattgagatcgttcggcacgataggacgatggagcag
attgtttttcctgtgcccaacatatgtgaatatctcacacgggagtccaagtgccgagtg
tacaatacgaccgaaagggatgaacaaggaagcaaagtgaatgactttttccagcaaaca
gaagatctctacaatgaaatgaagtggcagaagaaaattaggagtaaccctgccctgttc
tggttctcaaggcacatctctctctggggcagcatttccttcaacctggccgtgttcatc
aacttagccgttgctctcttctacccatttggggatgatggagatgaaggtacactttct
ccactgttctccattcttctgtggatagcagttgccatctgcacatccatgctgtttttc
ttctccaagcctgtgggtattcggccatttcttgtgtcgataatgctgagatcaatatat
acaataggtttggggcctacactcatactccttggagcagctaatctctgtaacaaaatc
gtgtttctggtgagtttcgtcgggaatcgtggcacgttcacccgagggtaccgcgcggtc
atcctggacgtggcgtttctgtaccacgtggcctacgtcctggtgtgcatgctgggcctc
tttatccacgaattcttctacagcttcctgctttttgatttggtgtacagagaggagact
ctgctcaatgtcatcaaaagtgtcacccggaacggccgctccattattctgactgcagtc
ctggctcttatcctcgtctacctgttttccattattgggttccttttcttgaaggatgac
ttcacgatggaagtggataggctgaaaaacaggactcccgttacaggcaattacgaggtt
cctaccacaaccttaagttccatgacggagacgtgtgacaagaacaactgctcagccacg
ataccagcttccagtacagctggggaggaatatgaagatggaattgaaaggacctgtgac
accctgcttatgtgcatcgtcacggtgttgaaccagggcctcaggaacggcgggggcgtc
ggggacgtgctgagaaggccatccaaggatgagcccttgtttgctgcccgagtggtctat
gatctcctcttctttttcattgtcatcatcatcgtccttaatttgattttcggtgttatc
attgacacctttgctgatctcagaagtgaaaaacagaaaaaggaagaaattctgaagacg
acctgtttcatctgtggactcgagagggacaagtttgacaataaaactgtctcatttgag
gagcacattaagtccgaacacaacatgtggcactacctgtacttcatcgtcctggtgaag
gtcaaagacccgacagagtacacgggacctgagagttacgtggcccagatgatcgtggag
aagaacctggactggtttcctcggatgcgagccatgtctctcgtgagcaatgaaggggac
agcgagcaaaacgagatccggagcctgcaggagaagctggagtcgaccatgagtctggtc
agacagctgtcgggtcagctggcggagctcaaggagcagatgacagaacaaaggaagaat
aagcagagactgggcttcctggggtcaaacacagcccatgtgaatcatcacatgccacca
cactga

DBGET integrated database retrieval system