KEGG   Oryctolagus cuniculus (rabbit): 100009030
Entry
100009030         CDS       T03373                                 

Gene name
WNT11, WNT-11
Definition
(RefSeq) Wnt family member 11
  KO
K01384  wingless-type MMTV integration site family, member 11
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04150  mTOR signaling pathway
ocu04310  Wnt signaling pathway
ocu04390  Hippo signaling pathway
ocu04550  Signaling pathways regulating pluripotency of stem cells
ocu04916  Melanogenesis
ocu04934  Cushing syndrome
ocu05010  Alzheimer disease
ocu05022  Pathways of neurodegeneration - multiple diseases
ocu05165  Human papillomavirus infection
ocu05200  Pathways in cancer
ocu05205  Proteoglycans in cancer
ocu05217  Basal cell carcinoma
ocu05224  Breast cancer
ocu05225  Hepatocellular carcinoma
ocu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100009030 (WNT11)
   04390 Hippo signaling pathway
    100009030 (WNT11)
   04150 mTOR signaling pathway
    100009030 (WNT11)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100009030 (WNT11)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100009030 (WNT11)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100009030 (WNT11)
   05205 Proteoglycans in cancer
    100009030 (WNT11)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100009030 (WNT11)
   05226 Gastric cancer
    100009030 (WNT11)
   05217 Basal cell carcinoma
    100009030 (WNT11)
   05224 Breast cancer
    100009030 (WNT11)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100009030 (WNT11)
   05022 Pathways of neurodegeneration - multiple diseases
    100009030 (WNT11)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100009030 (WNT11)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100009030 (WNT11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:ocu00536]
    100009030 (WNT11)
Glycosaminoglycan binding proteins [BR:ocu00536]
 Heparan sulfate / Heparin
  Morphogens
   100009030 (WNT11)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 100009030
NCBI-ProteinID: NP_001075693
Ensembl: ENSOCUG00000001726
UniProt: Q27Q51
LinkDB
Position
1
AA seq 354 aa
MRARPQVCEALLFALALHTGVCYGIKWLALSKTPAALALNQTQHCKQLEGLVSAQVQLCR
SNLELMHTIVRAAREVMKACRRAFADMRWNCSSIELAPNYLLDLERGTRESAFVYALSAA
AISHAIARACTSGDLPGCSCGPVPGEPPGPGNRWGGCADNLSYGLLMGAKFSDAPMKVKK
TGSQANKLMRLHNSEVGRQALRASLEVKCKCHGVSGSCSIRTCWKGLQELRDVAADLKSR
YLSATKVVHRPMGTRKHLVPKDLDIRPVKDSELVYLQSSPDFCMKNEKVGSHGTQDRQCN
KTSNGSDSCDLMCCGRGYNPYTDRVVERCHCKYHWCCYVTCRRCERAVERYVCK
NT seq 1065 nt   +upstreamnt  +downstreamnt
atgagggcgcggccgcaggtctgcgaggctctgctcttcgccctggcgctacacaccggc
gtgtgctatggcatcaagtggctggcgctgtccaagacgccggcggccttggcactgaac
cagacgcagcactgcaagcagctggagggcctggtgtccgcgcaggtgcagctgtgccgc
agcaacctggagctcatgcacaccatcgtgcgcgccgcccgcgaggtcatgaaggcctgc
cgcagggccttcgccgacatgcgctggaactgctcctccatcgagctcgcccccaactac
ctgctcgacctggagagagggacccgggagtcggccttcgtgtatgcgctgtcggcggct
gccatcagccacgccatcgcccgggcctgcacctctggcgacctgcccggctgctcctgc
ggccccgtcccaggtgagccacccgggcccgggaaccgctggggaggatgtgcggacaac
ctcagctacgggctcctcatgggggccaagttttccgatgctcctatgaaggtgaaaaaa
acaggatcccaagccaataaactgatgcgtctacacaacagtgaagtggggagacaggct
ctgcgtgcctctctggaagtgaagtgtaagtgccacggggtgtcgggctcctgctccatc
cgcacctgctggaaggggctgcaggagctgcgggatgtggccgctgacctcaagagccgc
tacctgtcggccaccaaggtggtgcacagacccatgggcacccgcaagcacctggtgccc
aaggacctggacatccggcccgtgaaggactcggagctcgtgtacctgcagagctcgccc
gacttctgcatgaagaacgagaaggtgggctcccacgggacccaggacaggcagtgcaac
aagacgtcgaatggcagcgacagctgtgacctcatgtgctgtgggcgcggctacaacccc
tacacggaccgcgtggtggagcggtgccactgcaagtaccactggtgctgctacgtgacg
tgccgccgctgtgagcgcgccgtggagcgctatgtctgcaagtga

KEGG   Oryctolagus cuniculus (rabbit): 100009033
Entry
100009033         CDS       T03373                                 

Gene name
WNT3
Definition
(RefSeq) Wnt family member 3
  KO
K00312  wingless-type MMTV integration site family, member 3
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04150  mTOR signaling pathway
ocu04310  Wnt signaling pathway
ocu04390  Hippo signaling pathway
ocu04550  Signaling pathways regulating pluripotency of stem cells
ocu04916  Melanogenesis
ocu04934  Cushing syndrome
ocu05010  Alzheimer disease
ocu05022  Pathways of neurodegeneration - multiple diseases
ocu05165  Human papillomavirus infection
ocu05200  Pathways in cancer
ocu05205  Proteoglycans in cancer
ocu05206  MicroRNAs in cancer
ocu05217  Basal cell carcinoma
ocu05224  Breast cancer
ocu05225  Hepatocellular carcinoma
ocu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100009033 (WNT3)
   04390 Hippo signaling pathway
    100009033 (WNT3)
   04150 mTOR signaling pathway
    100009033 (WNT3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100009033 (WNT3)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100009033 (WNT3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100009033 (WNT3)
   05206 MicroRNAs in cancer
    100009033 (WNT3)
   05205 Proteoglycans in cancer
    100009033 (WNT3)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100009033 (WNT3)
   05226 Gastric cancer
    100009033 (WNT3)
   05217 Basal cell carcinoma
    100009033 (WNT3)
   05224 Breast cancer
    100009033 (WNT3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100009033 (WNT3)
   05022 Pathways of neurodegeneration - multiple diseases
    100009033 (WNT3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100009033 (WNT3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100009033 (WNT3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:ocu00536]
    100009033 (WNT3)
Glycosaminoglycan binding proteins [BR:ocu00536]
 Heparan sulfate / Heparin
  Morphogens
   100009033 (WNT3)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 100009033
NCBI-ProteinID: XP_002719498
Ensembl: ENSOCUG00000014805
UniProt: G1T851
LinkDB
Position
19
AA seq 355 aa
MEPHLLRLLLGLLLGGTRALAGYPIWWSLALGQQYTSLGSQPLLCGSIPGLVPKQLRFCR
NYIEIMPSVAEGVKLGIQECQHQFRGRRWNCTTIDDSLAIFGPVLDKATRESAFVHAIAS
AGVAFAVTRSCAEGTSTICGCDSHHKGPPGEGWKWGGCSEDADFGVLVSREFADARENRP
DARSAMNKHNNEAGRTTILDHMHLKCKCHGLSGSCEVKTCWWAQPDFRAIGDFLKDKYDS
ASEMVVEKHRESRGWVETLRAKYALFKPPTERDLVYYENSPNFCEPNPETGSFGTRDRTC
NITSHGIDGCDLLCCGRGHNTRTEKRKEKCHCVFHWCCYVSCQECIRIYDVHTCK
NT seq 1068 nt   +upstreamnt  +downstreamnt
atggagccccacctgctccggctgctcctcggcctgctgctcggtggcaccagggccctc
gccggctacccaatttggtggtccctggccctgggccagcagtacacatctctgggctcc
cagcccctgctctgcggctccatcccaggcctggtccccaagcagctgcgcttctgccgc
aactacatcgagatcatgcccagcgtggccgagggcgtgaagctgggcatccaggagtgc
cagcaccagttccggggccgccgctggaactgcaccaccatagacgacagcctggccatc
ttcgggcccgtcctggacaaagccacccgggagtcggccttcgtgcacgccatcgcctcg
gccggcgtggccttcgccgtcacgcgctcctgcgccgagggcacctccaccatctgtggc
tgcgactctcatcacaaggggccgcccggcgaaggctggaagtggggcggctgcagcgaa
gacgccgacttcggggtgctggtgtcccgcgagttcgctgacgcccgcgagaaccggccg
gatgcccgctcggccatgaacaagcacaacaacgaggcgggccgcacgaccatcctggac
cacatgcacctcaagtgcaagtgccacgggctgtcgggcagctgcgaggtgaagacctgc
tggtgggcccagcccgacttccgtgccatcggcgacttcctcaaggacaagtacgacagc
gcctcggagatggtggtggagaagcaccgggagtcccggggctgggtggagaccctgcgc
gccaagtacgcgctcttcaagccgcccaccgagagggacctggtctactatgagaactcc
cccaacttctgcgagcccaacccagagacgggctcctttggcaccagggaccggacttgc
aacatcacctcccacggcattgacggctgcgacctgctgtgctgtggccgcggccacaac
acgaggacggagaagaggaaggagaagtgccactgcgtcttccactggtgctgctacgtc
agctgccaggagtgcatccgcatctacgacgtgcacacctgcaagtag

KEGG   Oryctolagus cuniculus (rabbit): 100009381
Entry
100009381         CDS       T03373                                 

Gene name
WNT5A, WNT-5A
Definition
(RefSeq) Wnt family member 5A
  KO
K00444  wingless-type MMTV integration site family, member 5
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04150  mTOR signaling pathway
ocu04310  Wnt signaling pathway
ocu04360  Axon guidance
ocu04390  Hippo signaling pathway
ocu04550  Signaling pathways regulating pluripotency of stem cells
ocu04916  Melanogenesis
ocu04934  Cushing syndrome
ocu05010  Alzheimer disease
ocu05022  Pathways of neurodegeneration - multiple diseases
ocu05165  Human papillomavirus infection
ocu05200  Pathways in cancer
ocu05205  Proteoglycans in cancer
ocu05217  Basal cell carcinoma
ocu05224  Breast cancer
ocu05225  Hepatocellular carcinoma
ocu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100009381 (WNT5A)
   04390 Hippo signaling pathway
    100009381 (WNT5A)
   04150 mTOR signaling pathway
    100009381 (WNT5A)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100009381 (WNT5A)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100009381 (WNT5A)
  09158 Development and regeneration
   04360 Axon guidance
    100009381 (WNT5A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100009381 (WNT5A)
   05205 Proteoglycans in cancer
    100009381 (WNT5A)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100009381 (WNT5A)
   05226 Gastric cancer
    100009381 (WNT5A)
   05217 Basal cell carcinoma
    100009381 (WNT5A)
   05224 Breast cancer
    100009381 (WNT5A)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100009381 (WNT5A)
   05022 Pathways of neurodegeneration - multiple diseases
    100009381 (WNT5A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100009381 (WNT5A)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100009381 (WNT5A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:ocu00536]
    100009381 (WNT5A)
Glycosaminoglycan binding proteins [BR:ocu00536]
 Heparan sulfate / Heparin
  Morphogens
   100009381 (WNT5A)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 100009381
NCBI-ProteinID: NP_001076134
Ensembl: ENSOCUG00000000380
UniProt: Q27Q52
LinkDB
Position
9
AA seq 380 aa
MKKSIGILSPGVALGTAGSAMSSKFFVMALAVFFSFAQVVIEANSWWSLGMNNPVQMSEV
YIIGAQPLCSQLAGLSQGQKKLCHLYQDHMQYIGEGAKTGIKECQYQFRHRRWNCSTVDN
TSVFGRVMQIGSRETAFTYAVSAAGVVNAMSRACREGELSTCGCSRAARPKDLPRDWLWG
GCGDNIDYGYRFAKEFVDARERERIHAKGSYESARILMNLHNNEAGRRTVYNLADVACKC
HGVSGSCSLKTCWLQLADFRKVGDALKEKYDSAAAMRLNSRGKLVQVNSRFNSPTTQDLV
YIDPSPDYCVRNESTGSLGTQGRLCNKTSEGMDGCELMCCGRGYDQFKTVQTERCHCKFH
WCCYVKCKKCTEIVDQFVCK
NT seq 1143 nt   +upstreamnt  +downstreamnt
atgaagaagtccattggcatattaagcccaggcgttgctttggggactgctggaagtgca
atgtcttccaagttcttcgtaatggctttggccgtatttttttccttcgcccaggttgta
atagaagccaattcttggtggtccctaggtatgaataaccctgttcagatgtcagaagta
tacatcataggagcgcagcctctctgcagccaactggcgggactttctcaaggacagaag
aaactgtgccacttgtatcaggaccacatgcagtacatcggggaaggcgcgaagaccggc
atcaaagaatgccagtatcagttccgacatcgaaggtggaactgcagcactgtggataac
acgtccgtcttcggcagagtgatgcagataggcagccgcgagacggccttcacgtacgct
gtgagcgccgcaggggtggtgaacgccatgagccgggcgtgccgggagggcgagctgtcc
acctgcggctgcagccgggcggcgcgccccaaagacctgccgcgggactggctctggggc
ggctgcggcgacaacatcgactacggataccgcttcgccaaggagtttgtggacgcacgc
gagcgggagcgcatccacgccaagggctcctatgagagcgcgcgcatcctcatgaacctg
cacaacaacgaggccggccgcaggacggtgtacaacctggccgatgtggcctgcaagtgc
cacggagtatccggctcgtgtagcctcaagacgtgctggctgcagctggcggacttccgc
aaggtgggcgacgcgctcaaggagaaatacgacagcgcggccgccatgcggctcaacagc
cggggcaagctggtgcaggtcaacagccgcttcaactcgcccaccacgcaggacctggtc
tacatcgaccccagccccgactactgtgtgcgcaacgagagcacgggctcgctgggcacc
cagggccgcctgtgcaacaagacgtccgagggcatggacggctgtgagcttatgtgctgc
ggccgcggctacgaccagttcaagacggtacagacagagcgctgccactgcaagttccac
tggtgctgctatgtcaagtgcaagaagtgcacggagatcgtggaccagtttgtgtgcaag
tag

KEGG   Oryctolagus cuniculus (rabbit): 100126569
Entry
100126569         CDS       T03373                                 

Gene name
WNT2
Definition
(RefSeq) Wnt family member 2
  KO
K00182  wingless-type MMTV integration site family, member 2
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04150  mTOR signaling pathway
ocu04310  Wnt signaling pathway
ocu04390  Hippo signaling pathway
ocu04550  Signaling pathways regulating pluripotency of stem cells
ocu04916  Melanogenesis
ocu04934  Cushing syndrome
ocu05010  Alzheimer disease
ocu05022  Pathways of neurodegeneration - multiple diseases
ocu05165  Human papillomavirus infection
ocu05200  Pathways in cancer
ocu05205  Proteoglycans in cancer
ocu05217  Basal cell carcinoma
ocu05224  Breast cancer
ocu05225  Hepatocellular carcinoma
ocu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100126569 (WNT2)
   04390 Hippo signaling pathway
    100126569 (WNT2)
   04150 mTOR signaling pathway
    100126569 (WNT2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100126569 (WNT2)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100126569 (WNT2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100126569 (WNT2)
   05205 Proteoglycans in cancer
    100126569 (WNT2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100126569 (WNT2)
   05226 Gastric cancer
    100126569 (WNT2)
   05217 Basal cell carcinoma
    100126569 (WNT2)
   05224 Breast cancer
    100126569 (WNT2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100126569 (WNT2)
   05022 Pathways of neurodegeneration - multiple diseases
    100126569 (WNT2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100126569 (WNT2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100126569 (WNT2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:ocu00536]
    100126569 (WNT2)
Glycosaminoglycan binding proteins [BR:ocu00536]
 Heparan sulfate / Heparin
  Morphogens
   100126569 (WNT2)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 100126569
NCBI-ProteinID: NP_001164513
Ensembl: ENSOCUG00000016173
UniProt: Q09YN1
LinkDB
Position
7
AA seq 360 aa
MNAPLGGIWLGLPLLLTWLSPEVSSSWWYMRATGDSSRVMCDNVPGLVSRQRQLCHRHPD
VMRAIGLGVAEWTAECQYQFRQHRWNCNTLDRDHGLFGRVLLRSSRESAFVYAISSAGVV
FAITRACSQGELKSCSCDPKKKGTAKDSKGTFDWGGCSDNIDYGIKFARAFVDAKERKGK
DARALMNLHNNRAGRKAVKRFLKQECKCHGVSGSCTLRTCWLAMADFRKTGDYLWRKYNG
AIQVVMNQDGTGFTVANKRFKKPTKNDLVYFENSPDYCIRDREAGSPGTAGRVCNLTSRG
MDSCEVMCCGRGYDTSRVTRMTKCECKFHWCCAVRCQDCLEALDVHTCKAPKSADWTTPT
NT seq 1083 nt   +upstreamnt  +downstreamnt
atgaacgcccctctcggtggaatctggctggggctccctctgctcttgacctggctcagc
cccgaggtcagctcttcatggtggtacatgagagctacaggtgactcctccagggtgatg
tgtgacaatgtgccaggcctggtgagccgccagcggcagctgtgccaccgacacccggac
gtgatgcgtgccataggcctgggtgtggccgagtggacagcagagtgccagtatcagttc
cgacagcaccgctggaactgcaacaccctggacagggatcacggcctctttggcagggtt
ctgctccgaagtagtcgggaatctgcctttgtatacgccatctcctcagctggagttgta
tttgccatcaccagggcctgtagccaaggagaattaaaatcctgttcctgtgatccaaag
aagaaaggaactgccaaggacagcaagggcaccttcgactggggtggctgcagtgataac
attgactatgggatcaagtttgcccgagcctttgtggatgccaaggaaaggaaaggaaag
gatgccagagcgctgatgaatcttcacaacaacagagcgggcaggaaggctgtaaagcgg
ttcttgaaacaagagtgcaagtgccacggtgtgagcggctcgtgtactctgcggacgtgc
tggctggccatggccgacttcaggaaaacgggcgattacctctggaggaagtacaatgga
gccatccaggtcgtcatgaaccaggatggcactggtttcactgtggctaacaagaggttt
aagaagccaacgaaaaatgaccttgtgtactttgagaattctccagactactgtatcagg
gaccgagaggcaggctccccgggtacagcaggtcgtgtgtgcaacctgacgtccagaggc
atggacagctgtgaagtcatgtgctgcgggagaggctacgacacctcccgcgtcacccgg
atgaccaagtgcgagtgtaagttccactggtgctgtgccgtgcgttgccaggactgcctg
gaggccctggacgtgcacacatgcaaggctcccaagagtgctgactggacaaccccaaca
tga

KEGG   Oryctolagus cuniculus (rabbit): 100303773
Entry
100303773         CDS       T03373                                 

Gene name
WNT4
Definition
(RefSeq) Wnt family member 4
  KO
K00408  wingless-type MMTV integration site family, member 4
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04150  mTOR signaling pathway
ocu04310  Wnt signaling pathway
ocu04360  Axon guidance
ocu04390  Hippo signaling pathway
ocu04550  Signaling pathways regulating pluripotency of stem cells
ocu04916  Melanogenesis
ocu04919  Thyroid hormone signaling pathway
ocu04934  Cushing syndrome
ocu05010  Alzheimer disease
ocu05022  Pathways of neurodegeneration - multiple diseases
ocu05165  Human papillomavirus infection
ocu05200  Pathways in cancer
ocu05205  Proteoglycans in cancer
ocu05217  Basal cell carcinoma
ocu05224  Breast cancer
ocu05225  Hepatocellular carcinoma
ocu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100303773 (WNT4)
   04390 Hippo signaling pathway
    100303773 (WNT4)
   04150 mTOR signaling pathway
    100303773 (WNT4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100303773 (WNT4)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    100303773 (WNT4)
   04916 Melanogenesis
    100303773 (WNT4)
  09158 Development and regeneration
   04360 Axon guidance
    100303773 (WNT4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100303773 (WNT4)
   05205 Proteoglycans in cancer
    100303773 (WNT4)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100303773 (WNT4)
   05226 Gastric cancer
    100303773 (WNT4)
   05217 Basal cell carcinoma
    100303773 (WNT4)
   05224 Breast cancer
    100303773 (WNT4)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100303773 (WNT4)
   05022 Pathways of neurodegeneration - multiple diseases
    100303773 (WNT4)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100303773 (WNT4)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100303773 (WNT4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:ocu00536]
    100303773 (WNT4)
Glycosaminoglycan binding proteins [BR:ocu00536]
 Heparan sulfate / Heparin
  Morphogens
   100303773 (WNT4)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 100303773
NCBI-ProteinID: XP_008263935
Ensembl: ENSOCUG00000022473
LinkDB
Position
13
AA seq 296 aa
MCKRNLEVMDSVRRGAQLAIEECQYQFRNRRWNCSTLDSLPVFGKVVTQGTREAAFVYAV
SSAGVAFAVTRACSSGELEKCGCDRTVHGVSPQGFQWSGCSDNIAYGVAFSQSFVDVRER
SKGASSSRALMNLHNNEAGRKAILSHMRVECKCHGVSGSCEVKTCWRAVPPFRQVGHALK
EKFDGATEVEPRRVGSSRALVPRNGAVQPQTDEDLGYLEPSPDFCEQDLRSGVLGTRGRT
CNKTSKAIDGCELLCCGRGFHTAQVELAERCSCKFHWCCFVKCRQCQRLVELHTCR
NT seq 891 nt   +upstreamnt  +downstreamnt
atgtgcaagcgcaacctggaggtgatggactcggtgcgccgcggcgcgcagctggccatc
gaggagtgccagtaccagttccggaaccggcgctggaactgctccacgctcgactccctg
cccgtcttcggcaaggtggtgacgcaagggactcgggaggcggccttcgtgtacgcagtc
tcctctgcaggggtggccttcgcggtgacacgggcgtgcagcagcggggagctggagaag
tgcggctgtgaccgcacggtgcacggggtcagcccccagggcttccagtggtcgggatgc
tcggacaacatcgcctacggcgtggccttctcgcagtccttcgtggacgtgcgggagagg
agcaagggtgcctcgtccagccgggcgctcatgaacctccataacaacgaggccggcaga
aaggccatcctgtcacacatgcgggtggagtgcaagtgccacggggtgtcgggctcctgc
gaggtgaagacgtgctggcgggcggtgccgcccttccgccaggtgggccacgcgctgaag
gagaagttcgacggcgccaccgaggtggagccacgccgggtgggctcctccagggccctg
gtgccgcgcaacggggcagttcaaccgcaaacggacgaggacctggggtacctggagccc
agcccggacttctgcgagcaggacttacgcagcggcgtgctgggcacgaggggccgcacc
tgcaacaagacgtccaaggccatcgacggctgcgagctgctgtgctgcggccgcggcttc
cacacggcgcaggtggagctggcggaacgctgcagctgcaaattccactggtgctgcttc
gtcaagtgccgccagtgccagcggctggtggagctgcacacgtgccggtga

KEGG   Oryctolagus cuniculus (rabbit): 100342870
Entry
100342870         CDS       T03373                                 

Gene name
WNT8A
Definition
(RefSeq) Wnt family member 8A
  KO
K00714  wingless-type MMTV integration site family, member 8
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04150  mTOR signaling pathway
ocu04310  Wnt signaling pathway
ocu04390  Hippo signaling pathway
ocu04550  Signaling pathways regulating pluripotency of stem cells
ocu04916  Melanogenesis
ocu04934  Cushing syndrome
ocu05010  Alzheimer disease
ocu05022  Pathways of neurodegeneration - multiple diseases
ocu05165  Human papillomavirus infection
ocu05200  Pathways in cancer
ocu05205  Proteoglycans in cancer
ocu05217  Basal cell carcinoma
ocu05224  Breast cancer
ocu05225  Hepatocellular carcinoma
ocu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100342870 (WNT8A)
   04390 Hippo signaling pathway
    100342870 (WNT8A)
   04150 mTOR signaling pathway
    100342870 (WNT8A)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100342870 (WNT8A)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100342870 (WNT8A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100342870 (WNT8A)
   05205 Proteoglycans in cancer
    100342870 (WNT8A)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100342870 (WNT8A)
   05226 Gastric cancer
    100342870 (WNT8A)
   05217 Basal cell carcinoma
    100342870 (WNT8A)
   05224 Breast cancer
    100342870 (WNT8A)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100342870 (WNT8A)
   05022 Pathways of neurodegeneration - multiple diseases
    100342870 (WNT8A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100342870 (WNT8A)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100342870 (WNT8A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:ocu00536]
    100342870 (WNT8A)
Glycosaminoglycan binding proteins [BR:ocu00536]
 Heparan sulfate / Heparin
  Morphogens
   100342870 (WNT8A)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 100342870
NCBI-ProteinID: XP_002710155
Ensembl: ENSOCUG00000005191
UniProt: G1SNE4
LinkDB
Position
3
AA seq 352 aa
MGDLVLLWVAVGMCSATFRASAWSVNNFLITGPKAYLTYTTSVALGAQSGIEECKFQFAW
ERWNCPENALQLSTHNRLRSATRETSFIHAISSAGVMHTITKNCSMGDFENCGCDESKNG
KTGGHGWIWGGCSDNVEFGERISKLFVDSLEKGKDARALMNLHNNRAGRLAVKATMRRTC
KCHGISGSCSIQTCWLQLADFREMGDYLKAKYDRALKIEMDKRRLRAGNSAEGHWAPTEA
FLPSAEAELVFLEESPDYCTRNSSLGVQGTEGRECLQHSHNTSRRERRSCGRLCSECGLQ
VEERRTEATSSCNCKFHWCCTVKCDQCRHVVNRYYCTRSPGTAQSWAKGSAW
NT seq 1059 nt   +upstreamnt  +downstreamnt
atgggagacctcgttctgctctgggtggctgtgggcatgtgcagtgccaccttccgtgcc
tctgcctggtcagtgaacaatttcctgataactggccctaaggcctacctgacctatact
accagcgtggccttgggggcccagagcggcattgaggagtgtaagttccagtttgcttgg
gaacgttggaactgcccggaaaatgctctccagctctccacccacaacaggctgagaagc
gccaccagagagacttccttcattcatgccatcagctcagctggagtcatgcacactatc
accaagaactgcagcatgggcgactttgaaaactgtggctgcgatgagtcaaaaaacggg
aaaacaggaggccatggctggatctggggaggctgcagcgacaatgtggaatttggggaa
aggatctccaaactctttgtggacagtttggagaaggggaaggatgccagagccctgatg
aatctccacaacaacagggccggcaggctggcagtgaaagccaccatgagaaggacctgc
aagtgtcacggcatctcggggagctgcagcatccagacctgctggttgcagctggctgac
ttccgggagatgggcgactacctgaaggccaagtacgaccgggcgctgaaaatcgagatg
gacaagcggcggctaagagctgggaacagcgccgagggccactgggcgcccacagaggcc
tttcttcctagtgcagaggccgagctggtctttctagaggagtcgccagattactgcacc
cgcaattccagcctgggcgtccagggcactgagggccgtgagtgcctgcagcacagccac
aacacctcccggagggagcgacgcagctgcgggcgcctgtgctccgagtgtgggctgcag
gtggaagagaggcgaaccgaggccaccagcagctgtaactgcaaattccactggtgctgc
acggtcaagtgtgaccagtgtaggcatgtggtgaacagatactactgcacccgctcccca
ggcacggcccagtcctgggctaagggcagtgcctggtaa

KEGG   Oryctolagus cuniculus (rabbit): 100348986
Entry
100348986         CDS       T03373                                 

Gene name
WNT6
Definition
(RefSeq) Wnt family member 6
  KO
K00445  wingless-type MMTV integration site family, member 6
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04150  mTOR signaling pathway
ocu04310  Wnt signaling pathway
ocu04390  Hippo signaling pathway
ocu04550  Signaling pathways regulating pluripotency of stem cells
ocu04916  Melanogenesis
ocu04934  Cushing syndrome
ocu05010  Alzheimer disease
ocu05022  Pathways of neurodegeneration - multiple diseases
ocu05165  Human papillomavirus infection
ocu05200  Pathways in cancer
ocu05205  Proteoglycans in cancer
ocu05217  Basal cell carcinoma
ocu05224  Breast cancer
ocu05225  Hepatocellular carcinoma
ocu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100348986 (WNT6)
   04390 Hippo signaling pathway
    100348986 (WNT6)
   04150 mTOR signaling pathway
    100348986 (WNT6)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100348986 (WNT6)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100348986 (WNT6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100348986 (WNT6)
   05205 Proteoglycans in cancer
    100348986 (WNT6)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100348986 (WNT6)
   05226 Gastric cancer
    100348986 (WNT6)
   05217 Basal cell carcinoma
    100348986 (WNT6)
   05224 Breast cancer
    100348986 (WNT6)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100348986 (WNT6)
   05022 Pathways of neurodegeneration - multiple diseases
    100348986 (WNT6)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100348986 (WNT6)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100348986 (WNT6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:ocu00536]
    100348986 (WNT6)
Glycosaminoglycan binding proteins [BR:ocu00536]
 Heparan sulfate / Heparin
  Morphogens
   100348986 (WNT6)
SSDB
Motif
Pfam: wnt Collagen
Other DBs
NCBI-GeneID: 100348986
NCBI-ProteinID: XP_008257392
Ensembl: ENSOCUG00000024007
LinkDB
Position
7
AA seq 365 aa
MLPPAPSRFGLLLLLLLCPAHVGGLWWAVGSPLVMDPTSICRKARRLAGRQAELCQAEPE
VVAELARGARLGVRECQFQFRFRRWNCSSHSKAFGRILQQDIRETAFVFAITAAGASHAV
TQACSMGELLQCGCQAPRGRGPPRPSGLPGTPGPPGPAGPADASAAWEWGGCGDDVDFGD
EKSRLFMDAQHKRGRGDIRALVQLHNNEAGRLAVRSHTRTECKCHGLSGSCALRTCWQKL
PPFREVGARLLERFHGASRVMGTNDGKALLPAVRTLKPPGRADLLYAADSPDFCAPNRRT
GSPGTRGRACNSSAPDLSGCDLLCCGRGHRQESVQLEENCLCRFHWCCVVQCHRCRVRKE
LSLCL
NT seq 1098 nt   +upstreamnt  +downstreamnt
atgctgccgcccgcgccctcccggttcgggttgctgctgctgctgctcctgtgtccggcg
cacgtcggaggactctggtgggccgtgggcagccccttggtcatggaccccaccagcatc
tgcaggaaggcacggcggctggcagggcggcaggcagagctgtgccaggccgagccggaa
gtggtggcagagctagcccgtggcgcccgactcggggtgcgagagtgccagttccagttc
cgcttccgccgctggaactgctccagccacagcaaggccttcggccgaatcctgcagcag
gacattcgggagacggccttcgtgttcgccatcaccgcggcaggtgccagccacgcggtc
acgcaggcctgttccatgggcgagctgctgcaatgcggctgccaggccccccgcgggcgg
ggcccgcctcggccctccggcctaccaggcaccccgggccccccgggtcccgcgggcccc
gcggacgccagcgccgcctgggagtggggaggctgcggcgacgacgtggacttcggggac
gagaaatcgaggctcttcatggacgcgcagcacaagcggggccgcggggacatccgcgcg
ctggtgcagctgcacaacaacgaagcgggccggctggccgtgcggagccacacgcgcacc
gagtgtaagtgccacgggctgtccggctcatgcgccctgcgcacctgctggcagaagctg
cccccgttccgcgaggtgggcgcgcggctgctggagcgcttccacggtgcctcgcgcgtc
atgggcaccaacgacggcaaggccctgctgcccgccgtccgcacgctcaagcccccgggc
cgcgccgacctcctctacgcggccgactcgcccgacttctgcgcccccaaccggcgcacc
ggctctccgggcacgcgcggccgcgcctgcaacagcagtgccccggacctcagcggctgc
gacctgttgtgctgcggccgcgggcaccgccaggagagcgtgcagctcgaggagaactgc
ctgtgccgcttccactggtgctgcgtggtgcagtgccaccgctgccgcgtgcgcaaagag
ctcagcctctgcctctga

KEGG   Oryctolagus cuniculus (rabbit): 100349579
Entry
100349579         CDS       T03373                                 

Gene name
WNT5B
Definition
(RefSeq) Wnt family member 5B
  KO
K00444  wingless-type MMTV integration site family, member 5
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04150  mTOR signaling pathway
ocu04310  Wnt signaling pathway
ocu04360  Axon guidance
ocu04390  Hippo signaling pathway
ocu04550  Signaling pathways regulating pluripotency of stem cells
ocu04916  Melanogenesis
ocu04934  Cushing syndrome
ocu05010  Alzheimer disease
ocu05022  Pathways of neurodegeneration - multiple diseases
ocu05165  Human papillomavirus infection
ocu05200  Pathways in cancer
ocu05205  Proteoglycans in cancer
ocu05217  Basal cell carcinoma
ocu05224  Breast cancer
ocu05225  Hepatocellular carcinoma
ocu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100349579 (WNT5B)
   04390 Hippo signaling pathway
    100349579 (WNT5B)
   04150 mTOR signaling pathway
    100349579 (WNT5B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100349579 (WNT5B)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100349579 (WNT5B)
  09158 Development and regeneration
   04360 Axon guidance
    100349579 (WNT5B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100349579 (WNT5B)
   05205 Proteoglycans in cancer
    100349579 (WNT5B)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100349579 (WNT5B)
   05226 Gastric cancer
    100349579 (WNT5B)
   05217 Basal cell carcinoma
    100349579 (WNT5B)
   05224 Breast cancer
    100349579 (WNT5B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100349579 (WNT5B)
   05022 Pathways of neurodegeneration - multiple diseases
    100349579 (WNT5B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100349579 (WNT5B)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100349579 (WNT5B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:ocu00536]
    100349579 (WNT5B)
Glycosaminoglycan binding proteins [BR:ocu00536]
 Heparan sulfate / Heparin
  Morphogens
   100349579 (WNT5B)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 100349579
NCBI-ProteinID: XP_002712821
Ensembl: ENSOCUG00000013686
LinkDB
Position
8
AA seq 359 aa
MPSLLLLFTAALLSSWAQLLADASSWWSLAMSPVQRPEMFIIGAQPVCSQLPGLSPGQRK
LCQLYQEHMAYIGEGAKMGIKECQYQFRQRRWNCSTVDNSSVFGRVMQIGSRETAFTYAV
SAAGVVNAISRACREGELSTCGCSRTARPKDLPRDWLWGGCGDNVEYGYRFAKEFVDARE
REKNFAKGSEEQGRVLMNLQNNEAGRRAVYKMADVACKCHGVSGSCSLKTCWLQLAEFRK
VGDQLKEKYDSAAAMRITRKGKLELVNSRFNQPTPEDLVYVDPSPDYCLRNETTGSLGTQ
GRICNKTSEGMDGCELMCCGRGYDQFKSVQVERCHCKFHWCCFVKCKKCTEIVDQYVCK
NT seq 1080 nt   +upstreamnt  +downstreamnt
atgcccagcctgctgctgctgttcactgctgctctgctctccagctgggcccagctcctg
gcagacgccagctcctggtggtccttagccatgagcccggtgcagagacctgagatgttt
atcatcggcgctcagcctgtgtgcagtcagcttcccgggctctcccctggccagagaaag
ctgtgccagctgtaccaggagcacatggcctacattggagagggagccaagatgggcatc
aaggagtgccagtaccagttccggcagaggcggtggaattgcagcacggtggacaactcg
tccgtctttgggagagtcatgcagataggcagccgcgagacggccttcacctacgccgtg
agcgccgcgggggtggtgaacgccatcagccgggcctgccgcgagggcgagctgtccacc
tgtggctgcagccggacagcgcggcccaaggacctgccccgggactggctgtggggtggc
tgcggggacaacgtggaatacggctaccgctttgctaaggagtttgtggacgcccgggag
cgggagaagaacttcgccaagggatcggaggagcagggccgcgtgctcatgaacctgcag
aacaacgaggcaggcagaagggctgtgtacaagatggcagacgtagcctgcaagtgccac
ggcgtctccggctcctgcagcctcaagacgtgctggctgcagctggccgagttccgcaag
gtgggggaccagctgaaggagaagtacgacagcgcggccgccatgcgcatcacccgcaag
ggcaagctggagctggtcaacagccgcttcaaccagcccacgcccgaggacctggtctac
gtggaccccagccctgactactgcctgcgcaacgagaccacgggctcgctgggcacgcag
ggccgcatctgcaacaagacctcggagggcatggacggctgtgagctcatgtgctgcggc
cgcggctacgaccagttcaagagcgtgcaggtggagcgctgccactgcaagttccactgg
tgctgctttgtcaagtgcaagaagtgcacggagatcgtggaccagtacgtctgcaaatag

KEGG   Oryctolagus cuniculus (rabbit): 100349847
Entry
100349847         CDS       T03373                                 

Gene name
WNT2B
Definition
(RefSeq) Wnt family member 2B
  KO
K00182  wingless-type MMTV integration site family, member 2
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04150  mTOR signaling pathway
ocu04310  Wnt signaling pathway
ocu04390  Hippo signaling pathway
ocu04550  Signaling pathways regulating pluripotency of stem cells
ocu04916  Melanogenesis
ocu04934  Cushing syndrome
ocu05010  Alzheimer disease
ocu05022  Pathways of neurodegeneration - multiple diseases
ocu05165  Human papillomavirus infection
ocu05200  Pathways in cancer
ocu05205  Proteoglycans in cancer
ocu05217  Basal cell carcinoma
ocu05224  Breast cancer
ocu05225  Hepatocellular carcinoma
ocu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100349847 (WNT2B)
   04390 Hippo signaling pathway
    100349847 (WNT2B)
   04150 mTOR signaling pathway
    100349847 (WNT2B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100349847 (WNT2B)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100349847 (WNT2B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100349847 (WNT2B)
   05205 Proteoglycans in cancer
    100349847 (WNT2B)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100349847 (WNT2B)
   05226 Gastric cancer
    100349847 (WNT2B)
   05217 Basal cell carcinoma
    100349847 (WNT2B)
   05224 Breast cancer
    100349847 (WNT2B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100349847 (WNT2B)
   05022 Pathways of neurodegeneration - multiple diseases
    100349847 (WNT2B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100349847 (WNT2B)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100349847 (WNT2B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:ocu00536]
    100349847 (WNT2B)
Glycosaminoglycan binding proteins [BR:ocu00536]
 Heparan sulfate / Heparin
  Morphogens
   100349847 (WNT2B)
SSDB
Motif
Pfam: wnt Herpes_LMP1
Other DBs
NCBI-GeneID: 100349847
NCBI-ProteinID: XP_002715814
Ensembl: ENSOCUG00000000266
UniProt: G1THI6
LinkDB
Position
13
AA seq 397 aa
MLRPGGAEEAAQLPPRRARAPAPAPAPAPAPRPAAPDGSPASARLGLACLLLLLLLTLPA
RVDSSWWYIGALGARVICDNIPGLVSRQRQLCQRYPDIMRSVGEGAREWIRECQHQFRHH
RWNCTTLDRDHTVFGRVMLRSSREAAFVYAISSAGVVHAITRACSQGELSVCSCDPYTRG
RHHDQRGDFDWGGCSDNIHYGVRFAKAFVDAKEKRLKDARALMNLHNNRCGRTAVRRFLK
LECKCHGVSGSCTLRTCWRALSDFRRTGDYLRRRYDGAVQVTATQDGANFTAARQGYRRA
TRTDLVYFDNSPDYCVLDKAAGSLGTAGRVCSKTSKGTDGCEIMCCGRGYDTTRVTRVTQ
CECKFHWCCAVRCKECRNTVDVHTCKAPKKAEWLDQT
NT seq 1194 nt   +upstreamnt  +downstreamnt
atgctgaggccgggtggtgcagaggaagccgcgcagctcccccctcggcgcgcccgcgcc
cctgcccctgcccctgcccctgcccccgcgcccagacccgcggcccccgacggctccccg
gcttcggcccgcctaggtcttgcctgcctgctgctgctgctgctgttgacgctgccagcc
cgcgtcgattcgtcttggtggtacatcggggcactgggggcccgagtgatctgtgacaat
atccctggtttggtgagccggcagcggcagctgtgccagcgttacccagacatcatgcgc
tcggtgggcgaaggtgcccgggaatggatccgagagtgtcagcaccagttccgccaccac
cgctggaactgcaccacactggaccgggaccacactgtctttggtcgtgtcatgctcaga
agtagccgggaggcagcttttgtatatgccatctcatccgcaggggtggtccatgccatc
actcgagcctgtagccagggtgaactgagtgtatgcagctgtgacccctacacgcgtggc
cgacaccacgaccaacgtggggactttgactggggtggctgcagtgacaacatccactat
ggcgtccgctttgccaaggccttcgtggatgccaaggagaagaggctgaaggatgcccgg
gccctcatgaacttacataacaaccgctgtgggcgcacggctgtgcggcggtttctgaag
ctggagtgcaagtgccacggcgtgagtggctcctgtactctgcgcacctgctggcgtgca
ctctcagacttccgtcgcacaggtgattacttgcgacggcgctacgatggggctgtgcag
gtgacagccacccaggacggtgccaacttcacagcagcccgccaaggctatcgccgtgcc
acccggactgatcttgtctacttcgacaactcccctgactactgtgtcttggacaaggct
gcaggttccctaggcactgctggccgtgtctgcagcaagacatcgaaaggaacggacggc
tgtgaaatcatgtgctgtggccgtgggtacgacacgactcgagttacccgtgtcacccag
tgtgagtgcaaattccactggtgctgtgcggtgcgctgcaaggaatgcagaaacactgtg
gacgtccatacttgcaaggcccccaagaaggcagagtggctagaccagacctga

KEGG   Oryctolagus cuniculus (rabbit): 100351316
Entry
100351316         CDS       T03373                                 

Gene name
WNT10B
Definition
(RefSeq) Wnt family member 10B
  KO
K01357  wingless-type MMTV integration site family, member 10
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04150  mTOR signaling pathway
ocu04310  Wnt signaling pathway
ocu04390  Hippo signaling pathway
ocu04550  Signaling pathways regulating pluripotency of stem cells
ocu04916  Melanogenesis
ocu04934  Cushing syndrome
ocu05010  Alzheimer disease
ocu05022  Pathways of neurodegeneration - multiple diseases
ocu05165  Human papillomavirus infection
ocu05200  Pathways in cancer
ocu05205  Proteoglycans in cancer
ocu05217  Basal cell carcinoma
ocu05224  Breast cancer
ocu05225  Hepatocellular carcinoma
ocu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100351316 (WNT10B)
   04390 Hippo signaling pathway
    100351316 (WNT10B)
   04150 mTOR signaling pathway
    100351316 (WNT10B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100351316 (WNT10B)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100351316 (WNT10B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100351316 (WNT10B)
   05205 Proteoglycans in cancer
    100351316 (WNT10B)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100351316 (WNT10B)
   05226 Gastric cancer
    100351316 (WNT10B)
   05217 Basal cell carcinoma
    100351316 (WNT10B)
   05224 Breast cancer
    100351316 (WNT10B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100351316 (WNT10B)
   05022 Pathways of neurodegeneration - multiple diseases
    100351316 (WNT10B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100351316 (WNT10B)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100351316 (WNT10B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:ocu00536]
    100351316 (WNT10B)
Glycosaminoglycan binding proteins [BR:ocu00536]
 Heparan sulfate / Heparin
  Morphogens
   100351316 (WNT10B)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 100351316
NCBI-ProteinID: XP_002711122
Ensembl: ENSOCUG00000009580
UniProt: G1SXH3
LinkDB
Position
4
AA seq 389 aa
MLEEPQQRTLPLGLAGLLLLAVCSRALSNEILGLKLPGEPPLTANTVCLTLSGLSKRQLG
LCLRSPDVTASALQGLHVAVHECQHQLRDQRWNCSALEGGGRLPHHSAILKRGFRESAFS
FSMLAAGVMHAVATACSLGKLVSCGCGWKGSGEQDRLRSKLLQLQALSRGKSFPHSLPSP
GPGSGSSPGPQDTWEWGGCNHDMDFGEKFSRDFLDSREAPRDIQARMRIHNNRVGRQVVT
ENLKRKCKCHGTSGSCQFKTCWRAAPEFRAVGAALRERLGRAIFIDTHNRNSGAFQPRLR
PRRLSGELVYFEKSPDFCERDPTVGSPGTRGRACNKTSRLLDGCGSLCCGRGHNVLRQTR
VERCHCRFHWCCYVLCDECKVTEWVNVCK
NT seq 1170 nt   +upstreamnt  +downstreamnt
atgctggaggagccccagcagcggactctgcccttgggcctcgcgggtctcctgctcctt
gcggtgtgcagtcgggcgctcagcaatgagattctgggcctgaagctgcccggggagccg
ccgctgacggccaacaccgtgtgcttgacgctgtccggcctaagcaagcgccagttgggc
ctgtgcctgcgcagccccgacgtgacggcctctgcgcttcagggtctgcacgtcgccgtg
cacgagtgccagcaccagctgcgcgaccagcgctggaactgctcggcactcgagggcggc
ggccgcctgccgcaccacagcgccatcctcaagcgcggtttccgcgagagtgccttctcc
ttctccatgctggctgctggggtaatgcatgcagtagccacagcctgcagcctgggcaag
ctggtgagctgtggctgtggctggaagggcagcggtgaacaggatcggctcaggtccaaa
ctgctgcagctgcaggcgctgtcccggggcaagagttttccccactccctgcccagccct
ggccccggctcaggctccagccctggcccccaggacacgtgggaatggggtggctgtaac
catgacatggactttggagagaagttctctcgggacttcttggattccagggaagctccc
cgggacatccaggcgagaatgagaatccataacaacagggtggggcgccaggtggtaact
gaaaacctgaagcggaaatgcaagtgccatggcacttcgggcagctgccagtttaaaacc
tgctggagggcagccccagagttccgggccgtgggggcagcgctgagggagcggctgggc
cgagccatcttcattgacacccacaaccgcaattccggagccttccaaccccgcctgcgt
ccccggcgcctctcaggagagctggtctactttgagaagtctcccgacttctgcgagcga
gaccccacggtgggctccccgggcacgagaggccgggcttgcaacaagaccagccgcctg
ctggatggctgcgggagcctgtgctgcggccgcgggcacaacgtgctccggcagacgcga
gttgagcgctgccactgccgcttccactggtgctgctatgtgctgtgtgacgagtgcaaa
gtcacggaatgggtcaatgtgtgcaagtga

KEGG   Oryctolagus cuniculus (rabbit): 100352227
Entry
100352227         CDS       T03373                                 

Gene name
WNT9A
Definition
(RefSeq) Wnt family member 9A
  KO
K01064  wingless-type MMTV integration site family, member 9
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04150  mTOR signaling pathway
ocu04310  Wnt signaling pathway
ocu04390  Hippo signaling pathway
ocu04550  Signaling pathways regulating pluripotency of stem cells
ocu04916  Melanogenesis
ocu04934  Cushing syndrome
ocu05010  Alzheimer disease
ocu05022  Pathways of neurodegeneration - multiple diseases
ocu05165  Human papillomavirus infection
ocu05200  Pathways in cancer
ocu05205  Proteoglycans in cancer
ocu05217  Basal cell carcinoma
ocu05224  Breast cancer
ocu05225  Hepatocellular carcinoma
ocu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100352227 (WNT9A)
   04390 Hippo signaling pathway
    100352227 (WNT9A)
   04150 mTOR signaling pathway
    100352227 (WNT9A)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100352227 (WNT9A)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100352227 (WNT9A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100352227 (WNT9A)
   05205 Proteoglycans in cancer
    100352227 (WNT9A)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100352227 (WNT9A)
   05226 Gastric cancer
    100352227 (WNT9A)
   05217 Basal cell carcinoma
    100352227 (WNT9A)
   05224 Breast cancer
    100352227 (WNT9A)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100352227 (WNT9A)
   05022 Pathways of neurodegeneration - multiple diseases
    100352227 (WNT9A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100352227 (WNT9A)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100352227 (WNT9A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:ocu00536]
    100352227 (WNT9A)
Glycosaminoglycan binding proteins [BR:ocu00536]
 Heparan sulfate / Heparin
  Morphogens
   100352227 (WNT9A)
SSDB
Motif
Pfam: wnt Clr5
Other DBs
NCBI-GeneID: 100352227
NCBI-ProteinID: XP_008250998
Ensembl: ENSOCUG00000026170
LinkDB
Position
Un
AA seq 404 aa
MGTGRSQRVPSCLRPPAGPFWGAWSHTAPGPVHSGRALHGVPPLALPSPTHRPAPATLLW
ARAHPHLSVPRLTGSEPLTILPLSLEPEAAAQAHYKACDRLKLERKQRRMCRRDPGVAET
LVEAVSMSALECQYQFRFERWNCTLEGRYRASLLKRGFKETAFLYAISSAGLTHALAKAC
SAGRMERCTCDEAPDLENREAWQWGGCGDNLKYSSKFVKEFLGRRSSKDLRARVDFHNNL
VGVKVIKAGVETTCKCHGVSGSCTVRTCWRQLAPFHEVGKHLKHKYETALKVGSTTNEAT
GEAGAISPPRGRASGMGGSDPLPRTPELVHLDDSPSFCLAGRFSPGTAGRRCHREKNCES
ICCGRGHNTQSRVVTRPCQCQVRWCCYVECRQCTQREEVYTCKG
NT seq 1215 nt   +upstreamnt  +downstreamnt
atggggactggcaggtcccaaagggtcccttcttgcctccggccccctgcaggccctttc
tggggtgcctggtcccacaccgctcctgggcctgtacactcaggccgggctctgcatggt
gttcctccgctggcgctccccagccccacccaccgccctgccccagccaccctgctctgg
gccagggctcaccctcacctctccgtgcccaggctaacgggcagcgagcccctgaccatc
ctccctctgagcctggaacccgaggcggctgcccaggcgcactacaaagcgtgcgaccgg
ctgaagctggagcggaagcaacggcgcatgtgccgccgggacccgggcgtggccgagacg
ctggtggaggcggtgagcatgagtgcgctcgagtgccagtaccagttccgcttcgagcgc
tggaactgcacgctggagggccgctaccgcgccagcctgctgaagcgaggcttcaaggag
acggccttcctctacgccatctcctcggccggactgacgcacgcgctggccaaggcgtgc
agcgcggggcgcatggagcgctgtacgtgcgacgaggcgcccgacctggagaaccgcgag
gcctggcagtggggcggctgtggcgacaacctcaagtacagcagcaagttcgtcaaggag
ttcctgggccggcggtccagcaaggacctgcgagcacgtgtggacttccataacaacctc
gtgggcgtgaaggtgatcaaggccggggtggagaccacatgcaagtgccacggtgtgtct
ggctcatgcacggtgcggacctgctggcggcagctggcgcccttccacgaggtgggcaag
cacctgaagcacaagtatgagactgcactcaaggtgggcagcaccaccaacgaagccact
ggcgaggcgggcgccatctccccgccacggggccgggcctcggggatgggcggcagtgac
cccctgccccgcacaccagagctcgtacacctggacgactcgcccagcttctgcctggct
ggccgcttctccccaggcaccgctggccgcaggtgccaccgggagaagaactgtgagagc
atctgctgtggccgcggccacaacacacagagccgggtggtgacaagaccctgccagtgc
caggtgcgctggtgctgctatgtggagtgtcgacagtgcacgcagcgcgaggaggtctac
acctgcaagggctga

KEGG   Oryctolagus cuniculus (rabbit): 100352839
Entry
100352839         CDS       T03373                                 

Gene name
WNT10A
Definition
(RefSeq) Wnt family member 10A
  KO
K01357  wingless-type MMTV integration site family, member 10
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04150  mTOR signaling pathway
ocu04310  Wnt signaling pathway
ocu04390  Hippo signaling pathway
ocu04550  Signaling pathways regulating pluripotency of stem cells
ocu04916  Melanogenesis
ocu04934  Cushing syndrome
ocu05010  Alzheimer disease
ocu05022  Pathways of neurodegeneration - multiple diseases
ocu05165  Human papillomavirus infection
ocu05200  Pathways in cancer
ocu05205  Proteoglycans in cancer
ocu05217  Basal cell carcinoma
ocu05224  Breast cancer
ocu05225  Hepatocellular carcinoma
ocu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100352839 (WNT10A)
   04390 Hippo signaling pathway
    100352839 (WNT10A)
   04150 mTOR signaling pathway
    100352839 (WNT10A)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100352839 (WNT10A)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100352839 (WNT10A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100352839 (WNT10A)
   05205 Proteoglycans in cancer
    100352839 (WNT10A)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100352839 (WNT10A)
   05226 Gastric cancer
    100352839 (WNT10A)
   05217 Basal cell carcinoma
    100352839 (WNT10A)
   05224 Breast cancer
    100352839 (WNT10A)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100352839 (WNT10A)
   05022 Pathways of neurodegeneration - multiple diseases
    100352839 (WNT10A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100352839 (WNT10A)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100352839 (WNT10A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:ocu00536]
    100352839 (WNT10A)
Glycosaminoglycan binding proteins [BR:ocu00536]
 Heparan sulfate / Heparin
  Morphogens
   100352839 (WNT10A)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 100352839
NCBI-ProteinID: XP_002712529
Ensembl: ENSOCUG00000016033
UniProt: G1TAR3
LinkDB
Position
7
AA seq 417 aa
MGSAHPRPWLRLRPRPQPRPPLWALLFFLLLLAAAVPRSAPNDILGLRLPPEPVLNANTV
CLTLPGLSRRQMEVCVRHPDVAASAIQGIQIAIHECQHQFRDQRWNCSSLETRNKIPYES
PIFSRGFRESAFAYAIAAAGVVHAVSNACALGKLRACGCDASRRGDEEAFRRKLHRLQLD
ALQRGKGLSHGVPEHPALPPASPGLQDSWEWGGCSPDVGFGERFSKDFLDSREPHRDIHA
RMRLHNNRVGRQAVMDNMRRKCKCHGTSGSCQLKTCWQVTPEFRAVGALLRNRFHRATLI
RPHNRNGGQLEPGPAGAPSPAPGTPGPRRRASPADLVYFEKSPDFCEREPRLDSAGTVGR
LCNKSSAGPDGCGSMCCGRGHNILRQTRSERCHCRFHWCCFVVCEECRITEWVSVCK
NT seq 1254 nt   +upstreamnt  +downstreamnt
atgggcagcgcccaccctcgcccctggctgcggctccgaccccggccccagccgcggccc
ccgctctgggcgctcctgttcttcctactgctgctggctgctgccgtgcccaggtcagca
cccaacgacatcctcggcctccgcctgcccccggagcccgtgctcaacgccaacacggtg
tgcttgacgttgcccggcctgagccggcggcagatggaggtgtgtgtgcgccacccggac
gtggccgcctcggccatccagggcattcagatcgccatccacgagtgccaacaccagttc
cgggaccagcgctggaactgctccagcctcgagactcgcaacaagatcccctacgagagc
cccatcttcagcagaggtttccgagagagcgccttcgcctatgccatcgcggcagccggt
gtggtgcacgccgtgtccaacgcgtgcgccctgggcaaactgcgggcgtgcggctgcgac
gcgtcccggcgcggggatgaggaggcctttcgtcggaagctgcaccgcttgcagctggac
gcgctgcaacgtggaaagggcctgagccacggggtcccggagcaccccgccctgcccccc
gccagcccgggcctgcaggactcctgggagtggggcggctgcagcccggatgtgggtttc
ggcgagcgcttctctaaggactttctggactcccgggagcctcaccgagacatccacgcg
cgcatgaggctccacaacaaccgggtcggtaggcaggcggtgatggacaacatgcggcgg
aagtgcaagtgtcacggcacgtcgggcagctgccagctcaagacgtgctggcaggtgacg
cccgagttccgcgccgtgggggcgctgctgcgcaaccgcttccaccgcgccacgctcatc
cggccgcacaaccgcaacggcggccagctggaacccggcccggcgggggcgccgtcccca
gcgccgggcacccccgggccgcgccgtcgggccagccccgccgacctggtctactttgag
aagtcacccgacttctgcgagcgcgagccgcgcctggactcggcgggcaccgtgggccgc
ctgtgcaacaagagcagcgcgggccccgacggctgcggcagcatgtgctgcggccgcggc
cacaacatcctacgccagacccgcagcgaacgctgccactgccgcttccactggtgctgc
ttcgtggtctgcgaagagtgccgcatcaccgagtgggtcagcgtctgcaagtga

KEGG   Oryctolagus cuniculus (rabbit): 100353090
Entry
100353090         CDS       T03373                                 

Gene name
WNT16
Definition
(RefSeq) Wnt family member 16
  KO
K01558  wingless-type MMTV integration site family, member 16
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04150  mTOR signaling pathway
ocu04310  Wnt signaling pathway
ocu04390  Hippo signaling pathway
ocu04550  Signaling pathways regulating pluripotency of stem cells
ocu04916  Melanogenesis
ocu04934  Cushing syndrome
ocu05010  Alzheimer disease
ocu05022  Pathways of neurodegeneration - multiple diseases
ocu05165  Human papillomavirus infection
ocu05200  Pathways in cancer
ocu05202  Transcriptional misregulation in cancer
ocu05205  Proteoglycans in cancer
ocu05217  Basal cell carcinoma
ocu05224  Breast cancer
ocu05225  Hepatocellular carcinoma
ocu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100353090 (WNT16)
   04390 Hippo signaling pathway
    100353090 (WNT16)
   04150 mTOR signaling pathway
    100353090 (WNT16)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100353090 (WNT16)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100353090 (WNT16)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100353090 (WNT16)
   05202 Transcriptional misregulation in cancer
    100353090 (WNT16)
   05205 Proteoglycans in cancer
    100353090 (WNT16)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100353090 (WNT16)
   05226 Gastric cancer
    100353090 (WNT16)
   05217 Basal cell carcinoma
    100353090 (WNT16)
   05224 Breast cancer
    100353090 (WNT16)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100353090 (WNT16)
   05022 Pathways of neurodegeneration - multiple diseases
    100353090 (WNT16)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100353090 (WNT16)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100353090 (WNT16)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:ocu00536]
    100353090 (WNT16)
Glycosaminoglycan binding proteins [BR:ocu00536]
 Heparan sulfate / Heparin
  Morphogens
   100353090 (WNT16)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 100353090
NCBI-ProteinID: XP_002712150
Ensembl: ENSOCUG00000014744
UniProt: G1U287
LinkDB
Position
7
AA seq 365 aa
MDRAALLGLPRLCALWAALLALFPCGAQGNWMWLGIASFGVPEKLGCANLPLSGRQKELC
KRKPYLLPSIREGARLGIQECRSQFRHERWNCRVAAPAAAAPLGTGPLFGYELSSGTKET
AFIYAVMAAGLVHAVTRSCSAGNMTECSCDTTLQNGGSASEGWHWGGCSDDVQYGMWFSR
KFLDFPIRNTTGKDSKVLLAMNLHNNEAGRQAVAKLMSVDCRCHGVSGSCAVKTCWKTMS
SFEKIGHLLKDKYENSIQISEKTKKKMHRREKDQRKLPIRKEDLLYVNKSPNYCVEDKKL
GIPGTQGRECNRTSEGADGCNLLCCGRGYNTHVVRHVERCECKFIWCCYVRCRRCESMTD
VHTCK
NT seq 1098 nt   +upstreamnt  +downstreamnt
atggaccgagcggcgctcctgggactgccacgcctgtgcgcgctgtgggcagccctgctc
gcgctgtttccctgcggagcccaaggaaactggatgtggttgggcatcgcctcctttggc
gtcccggagaagctgggctgcgccaacttgccgctgagcggccgccagaaggagctgtgc
aagaggaaaccgtacctgctgccgagcatccgcgagggcgcgcgcctgggcatccaggag
tgcaggagtcagttccggcacgagcgctggaactgcagggtcgccgccccggccgccgcc
gcgccgctcggcactgggcccctcttcggctacgagctgagcagcggcaccaaggagaca
gcatttatttatgctgtaatggctgcaggcctggtgcatgctgtgaccaggtcctgtagt
gcaggcaacatgacagaatgctcctgtgacaccaccttgcagaacggtgggtcggcaagc
gaaggctggcactgggggggctgctccgatgatgtccagtatggcatgtggttcagcagg
aagttcctagactttcccatcagaaacaccacagggaaggacagcaaagtactgctagca
atgaatctacataacaatgaagctgggaggcaggctgtcgccaagttgatgtcagtagac
tgccgctgccacggagtttctggctcttgtgctgttaaaacatgctggaaaaccatgtct
tcctttgaaaagatcggccatttgttgaaggataaatatgaaaatagtattcagatatca
gagaaaacaaagaagaaaatgcaccggagagaaaaagatcagaggaaactaccgattcgc
aaggaagatctgctctatgtcaataagtctcccaactactgtgtggaggacaagaaactg
ggcatcccagggactcaaggcagagaatgcaaccgcacttcggaaggggctgacggctgc
aacctcttatgctgtggccgaggatacaacacccatgtggtcaggcacgtggagaggtgt
gagtgtaagtttatctggtgctgctacgtccgctgcagaagatgcgaaagcatgactgat
gtccacacgtgtaagtaa

KEGG   Oryctolagus cuniculus (rabbit): 100353559
Entry
100353559         CDS       T03373                                 

Gene name
WNT9B
Definition
(RefSeq) Wnt family member 9B
  KO
K01064  wingless-type MMTV integration site family, member 9
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04150  mTOR signaling pathway
ocu04310  Wnt signaling pathway
ocu04390  Hippo signaling pathway
ocu04550  Signaling pathways regulating pluripotency of stem cells
ocu04916  Melanogenesis
ocu04934  Cushing syndrome
ocu05010  Alzheimer disease
ocu05022  Pathways of neurodegeneration - multiple diseases
ocu05165  Human papillomavirus infection
ocu05200  Pathways in cancer
ocu05205  Proteoglycans in cancer
ocu05217  Basal cell carcinoma
ocu05224  Breast cancer
ocu05225  Hepatocellular carcinoma
ocu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100353559 (WNT9B)
   04390 Hippo signaling pathway
    100353559 (WNT9B)
   04150 mTOR signaling pathway
    100353559 (WNT9B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100353559 (WNT9B)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100353559 (WNT9B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100353559 (WNT9B)
   05205 Proteoglycans in cancer
    100353559 (WNT9B)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100353559 (WNT9B)
   05226 Gastric cancer
    100353559 (WNT9B)
   05217 Basal cell carcinoma
    100353559 (WNT9B)
   05224 Breast cancer
    100353559 (WNT9B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100353559 (WNT9B)
   05022 Pathways of neurodegeneration - multiple diseases
    100353559 (WNT9B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100353559 (WNT9B)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100353559 (WNT9B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:ocu00536]
    100353559 (WNT9B)
Glycosaminoglycan binding proteins [BR:ocu00536]
 Heparan sulfate / Heparin
  Morphogens
   100353559 (WNT9B)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 100353559
NCBI-ProteinID: XP_017204738
LinkDB
Position
19
AA seq 380 aa
MQPLRPACRPGGRCLEPPGSPPIPRALHPWSAPTVSPEAHPLPPLIPSSLTGREVLTPFP
GLGTAAAPAQGGAHLKQCDLLKLSRRQKQLCRREPGLAETLRDAARLGLLECQFQFRQER
WNCSLEGRTGLLKRGFKETAFLYAVSSAALTHALARACSAGRMERCTCDDSPGLQSRQAW
QWGVCGDNLKYSTKFLSNFLGPKRGSKDLRARVDAHNTHVGIKAVKSGLRTTCKCHGVSG
SCAVRTCWKQLAPFRETGEVLKLRYDSAVKVSSATNEALGRLELWAPSKPGSPAKGLAPR
PGDLVYLEDSPSFCRPSKYSPGTAGRVCSREASCGSLCCGRGYDTQSRLVAFSCHCQVQW
CCYVECQQCVQEELVYTCKH
NT seq 1143 nt   +upstreamnt  +downstreamnt
atgcagccgctgaggccggcctgccgcccaggagggagatgcttggagcccccaggaagc
ccccccatccccagggctctgcacccttggtccgcacccactgtgtcccccgaggctcat
cccctccctcctctcatcccttccagcttgaccgggcgcgaggtcctgacgcccttcccc
ggcctgggcactgcggcggccccggcacaggggggcgcccacctgaagcagtgcgacctg
ctgaagctgtcccgccggcagaagcagctgtgccggcgcgagcccggcctggcagagacc
ctgcgggacgccgcgcgcctcggcctgctcgagtgccagttccagttccggcaggagcgc
tggaactgcagcctggaggggaggaccgggctgctcaagagaggcttcaaggagacggcc
ttcctgtacgcagtgtcctcggccgccctcacccacgcgctggcccgggcctgcagcgcc
gggcgcatggagcgctgcacctgcgatgactccccggggctgcagagccggcaggcctgg
cagtggggcgtgtgtggcgacaacctcaagtacagcaccaagtttctgagcaacttcctg
ggacccaagcgaggaagcaaggacctgcgggcacgggtggacgcccacaacacccacgtg
ggcatcaaggctgtgaagagcggcctcaggaccacgtgtaagtgccacggcgtgtcgggc
tcctgtgcggtgcgcacctgctggaagcagcttgccccgttccgcgagacgggcgaggtg
ctgaaactgcgctatgactcagctgtcaaggtgtccagcgccaccaacgaggccttgggc
cgcctggagctctgggccccctccaagccaggcagccccgccaagggcctggccccccgg
cccggggacctggtctacctggaagactcgcccagcttctgccggcccagcaaatactct
cccggcacggcgggcagggtgtgctcccgggaggccagctgcggcagcctgtgctgtggg
cggggctacgacacgcagagtcgcctggtggccttctcctgccactgccaggtgcagtgg
tgctgctacgtggagtgccagcagtgcgtgcaggaggagctggtgtacacctgtaagcac
tag

KEGG   Oryctolagus cuniculus (rabbit): 100354018
Entry
100354018         CDS       T03373                                 

Gene name
WNT1
Definition
(RefSeq) Wnt family member 1
  KO
K03209  wingless-type MMTV integration site family, member 1
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04150  mTOR signaling pathway
ocu04310  Wnt signaling pathway
ocu04390  Hippo signaling pathway
ocu04550  Signaling pathways regulating pluripotency of stem cells
ocu04916  Melanogenesis
ocu04934  Cushing syndrome
ocu05010  Alzheimer disease
ocu05022  Pathways of neurodegeneration - multiple diseases
ocu05165  Human papillomavirus infection
ocu05200  Pathways in cancer
ocu05205  Proteoglycans in cancer
ocu05217  Basal cell carcinoma
ocu05224  Breast cancer
ocu05225  Hepatocellular carcinoma
ocu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100354018 (WNT1)
   04390 Hippo signaling pathway
    100354018 (WNT1)
   04150 mTOR signaling pathway
    100354018 (WNT1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100354018 (WNT1)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100354018 (WNT1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100354018 (WNT1)
   05205 Proteoglycans in cancer
    100354018 (WNT1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100354018 (WNT1)
   05226 Gastric cancer
    100354018 (WNT1)
   05217 Basal cell carcinoma
    100354018 (WNT1)
   05224 Breast cancer
    100354018 (WNT1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100354018 (WNT1)
   05022 Pathways of neurodegeneration - multiple diseases
    100354018 (WNT1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100354018 (WNT1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100354018 (WNT1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:ocu00536]
    100354018 (WNT1)
Glycosaminoglycan binding proteins [BR:ocu00536]
 Heparan sulfate / Heparin
  Morphogens
   100354018 (WNT1)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 100354018
NCBI-ProteinID: XP_002711131
Ensembl: ENSOCUG00000026066
UniProt: G1U5M0
LinkDB
Position
4
AA seq 370 aa
MGCWALLPSWVSPALLLALAALPAALAANSSGRWWGIVNVASSTNLLTDSKSLQLVLEPS
LQLLSRKQRRLIRQNPGILHSVSGGLQSAVRECKWQFRNRRWNCPTAPGPHLFGKIVNRG
CRETAFIFAITSAGVTHSVARSCSEGSIESCTCDYRRRGPGGPDWHWGGCSDNIDFGRLF
GREFVDSGEKGRDLRFLMNLHNNEAGRTTVFSEMRQECKCHGMSGSCTVRTCWMRLPTLR
AVGDVLRDRFDGASRVLYGNRGSNRASRAELLRLEPEDPAHKPPSPHDLVYFEKSPNFCT
YSGRLGTAGTTGRACNSSSPALDGCELLCCGRGHRTRTQRVTERCNCTFHWCCHVSCRNC
THTRVLHECL
NT seq 1113 nt   +upstreamnt  +downstreamnt
atggggtgctgggcgctgctgcccagctgggtttctcctgcgctgctactggcgctggcc
gccctgcccgcagctctggcggccaacagcagcggccgatggtggggcatcgtaaacgtc
gcttcctccacgaacctgctaactgactccaagagcctgcagctggtgctggagcccagt
ctgcagctcctgagccgcaaacagcggcgcctgatccggcagaacccaggcatcctgcac
agcgtgagcggggggctgcagagcgccgtgcgcgagtgcaagtggcaattccggaaccgc
cgctggaactgccccaccgcgccggggccccacctcttcggcaagatcgtcaaccgaggc
tgccgggaaacagcttttatcttcgccatcacctctgcgggggtcacccactcggtggcg
cgctcctgctccgagggttccatcgagtcttgcacgtgcgactatcggcggcgcggcccc
gggggccccgactggcactgggggggctgcagcgacaacatcgacttcggccgcctcttt
ggcagggaattcgtggactccggggagaaggggcgggacttgcgctttctcatgaacctg
cacaacaacgaggcgggccgcacgaccgtcttctctgagatgcgccaggagtgcaagtgc
cacggcatgtcgggctcgtgcaccgtgcgcacgtgctggatgcggctgcccacgctgcgc
gccgtgggcgacgtgctgcgcgaccgcttcgacggcgcctcgcgcgttctctacggcaac
cgcggtagcaaccgcgcttcgcgggcggagctgctgcgcctggagcccgaggacccggcg
cacaagccgccctccccacacgacctggtctactttgagaaatcgcccaacttctgcacg
tacagcggacgcctgggcaccgcgggcaccacggggcgagcctgcaacagctcgtcgccg
gctctggacggctgcgagctgctgtgctgcggtcggggccaccgcacgcgcacgcagcgc
gtcaccgagcgctgcaattgcaccttccactggtgctgtcatgtcagctgccgcaactgc
acgcatacgcgcgtgctgcacgagtgtctgtga

KEGG   Oryctolagus cuniculus (rabbit): 100354583
Entry
100354583         CDS       T03373                                 

Gene name
WNT3A
Definition
(RefSeq) Wnt family member 3A
  KO
K00312  wingless-type MMTV integration site family, member 3
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04150  mTOR signaling pathway
ocu04310  Wnt signaling pathway
ocu04390  Hippo signaling pathway
ocu04550  Signaling pathways regulating pluripotency of stem cells
ocu04916  Melanogenesis
ocu04934  Cushing syndrome
ocu05010  Alzheimer disease
ocu05022  Pathways of neurodegeneration - multiple diseases
ocu05165  Human papillomavirus infection
ocu05200  Pathways in cancer
ocu05205  Proteoglycans in cancer
ocu05206  MicroRNAs in cancer
ocu05217  Basal cell carcinoma
ocu05224  Breast cancer
ocu05225  Hepatocellular carcinoma
ocu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100354583 (WNT3A)
   04390 Hippo signaling pathway
    100354583 (WNT3A)
   04150 mTOR signaling pathway
    100354583 (WNT3A)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100354583 (WNT3A)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100354583 (WNT3A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100354583 (WNT3A)
   05206 MicroRNAs in cancer
    100354583 (WNT3A)
   05205 Proteoglycans in cancer
    100354583 (WNT3A)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100354583 (WNT3A)
   05226 Gastric cancer
    100354583 (WNT3A)
   05217 Basal cell carcinoma
    100354583 (WNT3A)
   05224 Breast cancer
    100354583 (WNT3A)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100354583 (WNT3A)
   05022 Pathways of neurodegeneration - multiple diseases
    100354583 (WNT3A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100354583 (WNT3A)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100354583 (WNT3A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:ocu00536]
    100354583 (WNT3A)
Glycosaminoglycan binding proteins [BR:ocu00536]
 Heparan sulfate / Heparin
  Morphogens
   100354583 (WNT3A)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 100354583
NCBI-ProteinID: XP_002723899
Ensembl: ENSOCUG00000004048
UniProt: G1SKY6
LinkDB
Position
Un
AA seq 351 aa
MAPLGYFLLLCSLRPALGSYPIWWSLAVGPQHSSLGTHPVLCASIPGLVPKQLRFCRNYV
EIMPSVAEGVRLAVQECQHQFRGRRWNCTTVDSLAIFGPVLDRATRESAFVHAIASAGVA
FAVTRSCAEGSATICGCSSRHPGSPGEGWKWGGCSEDIEFGGMVSREFADARENRPDARS
AMNRHNNEAGRQAIASHVHLKCKCHGLSGSCEVKTCWRAQPAFRAVGDLLKDKYDSASEM
VVEKHREARGWVETLRPRYAHFKVPTERDLVYYEASPNFCEPNPDTGSFGTRDRACNVSS
PGIDGCDLLCCGRGHNARTERRREKCRCVFHWCCYVSCHECARVLDVHTCK
NT seq 1056 nt   +upstreamnt  +downstreamnt
atggctccgctgggatacttcttgctgctgtgcagcttgaggccggcgctgggcagctac
cccatctggtggtccctggccgtcgggccgcagcactcctcgctgggcacgcatcccgtg
ctgtgtgccagcatccccggcctggtgcccaagcagctgcgcttctgcaggaactacgtg
gagatcatgcccagcgtggcggagggcgtgcggctggccgtccaggagtgtcagcaccag
ttccgcggccgccgctggaactgcaccaccgtcgacagcctggccatcttcggccctgtg
ctggacagagccacccgggagtcagccttcgtgcacgccattgcctccgctggcgtggcc
tttgctgtgacgcgttcctgcgcagagggctcagccaccatctgcggctgcagcagccgt
cacccgggctcccctggtgagggctggaagtggggcggctgcagtgaggacatcgagttt
ggtgggatggtgtcacgggagtttgccgacgcccgggagaaccggccggatgcccgctca
gccatgaaccgccacaacaacgaggccgggcgccaggccatcgccagccacgtgcacctg
aagtgcaagtgccacgggctgtccggcagctgcgaggtgaagacctgctggcgcgcgcag
ccggccttccgagccgtgggcgacctgctcaaggacaagtacgacagcgcctcggagatg
gtggtggagaagcaccgcgaggcgcgcggctgggtagagacgctgcggccgcgctacgcc
cacttcaaggtgcccacggaacgcgacctggtctattacgaggcctcgcccaacttctgc
gagcccaaccctgacacgggctccttcggcacgcgcgaccgcgcctgcaatgtgagctca
cccggcatcgacggctgtgacctgctgtgctgcggccgcggccacaacgcacgcaccgag
cggcgtcgggagaagtgccgctgcgtcttccactggtgctgctacgtgagctgccacgag
tgcgcacgcgtgctggacgtgcatacctgcaagtag

KEGG   Oryctolagus cuniculus (rabbit): 100355697
Entry
100355697         CDS       T03373                                 

Gene name
WNT7A
Definition
(RefSeq) Wnt family member 7A
  KO
K00572  wingless-type MMTV integration site family, member 7
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04150  mTOR signaling pathway
ocu04310  Wnt signaling pathway
ocu04390  Hippo signaling pathway
ocu04550  Signaling pathways regulating pluripotency of stem cells
ocu04916  Melanogenesis
ocu04934  Cushing syndrome
ocu05010  Alzheimer disease
ocu05022  Pathways of neurodegeneration - multiple diseases
ocu05165  Human papillomavirus infection
ocu05200  Pathways in cancer
ocu05205  Proteoglycans in cancer
ocu05217  Basal cell carcinoma
ocu05224  Breast cancer
ocu05225  Hepatocellular carcinoma
ocu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100355697 (WNT7A)
   04390 Hippo signaling pathway
    100355697 (WNT7A)
   04150 mTOR signaling pathway
    100355697 (WNT7A)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100355697 (WNT7A)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100355697 (WNT7A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100355697 (WNT7A)
   05205 Proteoglycans in cancer
    100355697 (WNT7A)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100355697 (WNT7A)
   05226 Gastric cancer
    100355697 (WNT7A)
   05217 Basal cell carcinoma
    100355697 (WNT7A)
   05224 Breast cancer
    100355697 (WNT7A)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100355697 (WNT7A)
   05022 Pathways of neurodegeneration - multiple diseases
    100355697 (WNT7A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100355697 (WNT7A)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100355697 (WNT7A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:ocu00536]
    100355697 (WNT7A)
Glycosaminoglycan binding proteins [BR:ocu00536]
 Heparan sulfate / Heparin
  Morphogens
   100355697 (WNT7A)
SSDB
Motif
Pfam: wnt COG6
Other DBs
NCBI-GeneID: 100355697
NCBI-ProteinID: XP_008258519
Ensembl: ENSOCUG00000013432
LinkDB
Position
9
AA seq 349 aa
MNGKARRCLGHLFLSLGMAYLRIGGFSSVVALGASIICNKIPGLAPRQRAICQSRPDAII
VIGEGSQMGLDECQFQFRNGRWNCSALGERTVFGKELKVGSREAAFTYAIIAAGVAHAIT
AACTQGNLSDCGCDKEKQGQYHRDEGWKWGGCSADIRYGIGFAKVFVDAREIKQNARTLM
NLHNNEAGRKILEENMKLECKCHGVSGSCTTKTCWTTLPQFRELGYVLKDKYNEAVHVEP
VRASRNKRPTFLKIKKPLSYRKPMDTDLVYIEKSPNYCEEDPVTGSVGTQGRACNKTAPQ
ASGCDLMCCGRGYNTHQYARVWQCNCKFHWCCYVKCNTCSERTEMYTCK
NT seq 1050 nt   +upstreamnt  +downstreamnt
atgaacgggaaggcgcggcgctgcttgggccacctctttctcagcctgggcatggcctac
ctccggatcggtggcttctcctcggtggttgctctgggagccagcatcatctgtaacaag
atcccaggcctggctcccagacagcgggcgatctgccagagccggccggacgccatcatc
gtcataggagaaggctcgcaaatgggcctggacgagtgtcagtttcagttccgcaatggc
cgctggaactgctcggcgctgggcgagcgcacggtcttcggaaaggagctcaaagtgggg
agccgggaggctgccttcacgtacgccatcatcgctgccggcgtggcccacgccatcaca
gcggcctgtacccagggcaacctgagcgactgcggctgcgacaaggagaagcaaggccag
taccaccgggacgagggctggaagtggggtggctgctccgccgacatccgctacggcatc
ggcttcgccaaggtctttgtggatgcccgggagatcaagcagaatgcccggacgctcatg
aacttgcacaataacgaggcgggccgcaagatcctggaggagaacatgaagctggagtgc
aagtgccacggtgtgtcgggctcgtgcaccactaagacctgctggaccacgctgccccag
ttccgggagctgggctacgtgctcaaggacaagtacaacgaggccgtgcacgtggagccg
gtgcgcgccagccgtaacaagcgtcccaccttcctgaagatcaagaagccactgtcgtac
cgcaagcccatggacacggacctggtgtacatcgagaagtcgcccaactactgcgaggag
gacccggtgacgggcagcgtgggcacgcagggccgtgcctgcaacaagacggccccccag
gccagcggctgcgacctcatgtgctgcggccgcggctacaacacccaccagtacgcccgc
gtgtggcagtgcaactgtaagttccactggtgctgctacgtcaaatgcaacacgtgcagc
gagcgcactgagatgtacacgtgcaagtga

KEGG   Oryctolagus cuniculus (rabbit): 100357933
Entry
100357933         CDS       T03373                                 

Gene name
WNT8B
Definition
(RefSeq) Wnt family member 8B
  KO
K00714  wingless-type MMTV integration site family, member 8
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04150  mTOR signaling pathway
ocu04310  Wnt signaling pathway
ocu04390  Hippo signaling pathway
ocu04550  Signaling pathways regulating pluripotency of stem cells
ocu04916  Melanogenesis
ocu04934  Cushing syndrome
ocu05010  Alzheimer disease
ocu05022  Pathways of neurodegeneration - multiple diseases
ocu05165  Human papillomavirus infection
ocu05200  Pathways in cancer
ocu05205  Proteoglycans in cancer
ocu05217  Basal cell carcinoma
ocu05224  Breast cancer
ocu05225  Hepatocellular carcinoma
ocu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100357933 (WNT8B)
   04390 Hippo signaling pathway
    100357933 (WNT8B)
   04150 mTOR signaling pathway
    100357933 (WNT8B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100357933 (WNT8B)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100357933 (WNT8B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100357933 (WNT8B)
   05205 Proteoglycans in cancer
    100357933 (WNT8B)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100357933 (WNT8B)
   05226 Gastric cancer
    100357933 (WNT8B)
   05217 Basal cell carcinoma
    100357933 (WNT8B)
   05224 Breast cancer
    100357933 (WNT8B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100357933 (WNT8B)
   05022 Pathways of neurodegeneration - multiple diseases
    100357933 (WNT8B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100357933 (WNT8B)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100357933 (WNT8B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:ocu00536]
    100357933 (WNT8B)
Glycosaminoglycan binding proteins [BR:ocu00536]
 Heparan sulfate / Heparin
  Morphogens
   100357933 (WNT8B)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 100357933
NCBI-ProteinID: XP_017203983
Ensembl: ENSOCUG00000000986
UniProt: G1SEH4
LinkDB
Position
18
AA seq 351 aa
MFREKPCVCVFLFTCVLQLSHTWSVNNFLMTGPKAYLIYSSSVAAGAQSGIEECKYQFAW
DRWNCPERALQLSSHGGLRSANRETAFVHAISSAGVMYTLTRNCSLGDFDNCGCDDSRNG
QLGGQGWLWGGCSDNVGFGEAISKQFVDALETGQDARAAMNLHNNEAGRKAVKGTMKRTC
KCHGVSGSCTTQTCWLQLPEFREVGAHLKEKYHAALKVDLLQGAGNSAAGRGAIADTFRS
ISTRELVHLEDSPDYCLENKTLGLLGTEGRECLRRGRALGRWERRSCRRLCGDCGLAVEE
RRAETVSSCNCKFHWCCAVRCEQCRRRITKYFCSRAERPRGGAAHKAGRKP
NT seq 1056 nt   +upstreamnt  +downstreamnt
atgtttcgggagaagccctgtgtgtgtgtctttctgttcacctgtgtcctccagctcagc
cacacctggtccgtgaacaatttcctgatgactggtccaaaggcatacctgatctactcc
agcagcgtggcggctggggcccagagcggcattgaggaatgcaagtaccagtttgcctgg
gaccgctggaactgcccggagcgcgccctgcagctgtccagccatggcgggctgcgcagt
gcgaaccgcgagacggcgttcgtgcacgccatcagctccgccggcgtcatgtacaccctg
accaggaactgcagcctgggcgattttgacaactgcggctgtgacgactcccgaaacggg
cagctggggggccaaggctggctttggggaggctgcagtgacaacgtgggcttcggagag
gccatttccaagcagttcgtcgatgccctggagacaggacaggacgcccgggcggccatg
aacctgcacaacaacgaggccggccgcaaggcggtgaagggcaccatgaaacgcacgtgc
aagtgccacggcgtgtccggcagctgcaccacgcagacctgctggctgcagctgcccgag
ttccgcgaggtgggcgcgcacctcaaagagaagtaccacgcggcgctcaaggtggacctg
ctgcagggcgccggcaacagcgcggccggccgcggcgccatcgccgacaccttccgctcc
atctccacccgggagctcgtgcacctggaagactccccggactactgcctggagaacaaa
acgctagggctgctgggcaccgagggccgagagtgcctgcggcgggggcgggccctgggc
cgctgggagcgccgcagctgccgccggctgtgcggggactgcgggctggcggtggaggag
cgccgcgccgagaccgtgtccagctgcaactgcaagttccactggtgctgcgccgtccgc
tgcgagcagtgccgccggcgcatcaccaagtacttctgcagccgcgcggagcggccgcgg
gggggcgctgcccacaaggccgggaggaagccctag

KEGG   Oryctolagus cuniculus (rabbit): 103347432
Entry
103347432         CDS       T03373                                 

Definition
(RefSeq) protein Wnt-2b-like
  KO
K00572  wingless-type MMTV integration site family, member 7
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04150  mTOR signaling pathway
ocu04310  Wnt signaling pathway
ocu04390  Hippo signaling pathway
ocu04550  Signaling pathways regulating pluripotency of stem cells
ocu04916  Melanogenesis
ocu04934  Cushing syndrome
ocu05010  Alzheimer disease
ocu05022  Pathways of neurodegeneration - multiple diseases
ocu05165  Human papillomavirus infection
ocu05200  Pathways in cancer
ocu05205  Proteoglycans in cancer
ocu05217  Basal cell carcinoma
ocu05224  Breast cancer
ocu05225  Hepatocellular carcinoma
ocu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    103347432
   04390 Hippo signaling pathway
    103347432
   04150 mTOR signaling pathway
    103347432
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    103347432
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    103347432
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103347432
   05205 Proteoglycans in cancer
    103347432
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    103347432
   05226 Gastric cancer
    103347432
   05217 Basal cell carcinoma
    103347432
   05224 Breast cancer
    103347432
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103347432
   05022 Pathways of neurodegeneration - multiple diseases
    103347432
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103347432
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    103347432
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:ocu00536]
    103347432
Glycosaminoglycan binding proteins [BR:ocu00536]
 Heparan sulfate / Heparin
  Morphogens
   103347432
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 103347432
NCBI-ProteinID: XP_008252185
LinkDB
Position
Un
AA seq 203 aa
MTLWFRSWVCALEVENRGCDSNLYLHVQGKPGSQSWLRTGRGCGTLPWSSVCSRGWGPRF
LRRPGQAGPFQTRITRDRAGVSSCSPGLTAPCLSCLGRALSSVVALGANIICNKIPGLAP
RQRAICQSRPDAIIVIGEGAQMGINECQYQFRFGRWNCSALGEKTVFGQELRVGKGTPGL
AWPLGWRGPWAGVAPGLAWPLGW
NT seq 610 nt   +upstreamnt  +downstreamnt
atgaccctgtggttccgttcctgggtgtgtgccctagaggtggaaaacaggggctgtgac
agcaacttgtacctgcatgtgcagggaaagcccggctcccagagctggctccgcacaggg
cgcggctgtgggactctgccctggagctctgtctgctcccggggctgggggcctcggttc
ctgcgacgcccaggccaggcgggtcctttccaaacccggatcacgcgggatagggcgggg
gtgtcctcctgctcacccggcctcaccgccccatgcctgtcctgtcttggcagagcgctg
tcgtcggtggtggccctgggagccaacatcatctgcaacaagattcccggcttggcaccg
cggcaacgcgccatctgccagagccggcccgacgccatcatcgtcatcggggagggggca
cagatgggcatcaacgagtgccagtaccagttccgcttcggccgctggaactgctcggcc
ctgggcgagaagaccgtgttcgggcaggagctccgagtcggtaagggcacccctgggctg
gcgtggcccctgggctggcgtggcccctgggctggagtggcccctgggctggcgtggccc
ctgggctgga

DBGET integrated database retrieval system