KEGG   Oryctolagus cuniculus (rabbit): 100009072
Entry
100009072         CDS       T03373                                 

Gene name
RAB11A, RAB11
Definition
(RefSeq) RAB11A, member RAS oncogene family
  KO
K07904  Ras-related protein Rab-11A
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04144  Endocytosis
ocu04961  Endocrine and other factor-regulated calcium reabsorption
ocu04962  Vasopressin-regulated water reabsorption
ocu04972  Pancreatic secretion
ocu05164  Influenza A
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100009072 (RAB11A)
 09150 Organismal Systems
  09154 Digestive system
   04972 Pancreatic secretion
    100009072 (RAB11A)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    100009072 (RAB11A)
   04961 Endocrine and other factor-regulated calcium reabsorption
    100009072 (RAB11A)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    100009072 (RAB11A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100009072 (RAB11A)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ocu04147]
    100009072 (RAB11A)
   04031 GTP-binding proteins [BR:ocu04031]
    100009072 (RAB11A)
Membrane trafficking [BR:ocu04131]
 Protein recycling
  Rab GTPases and associated proteins
   Rab GTPases
    100009072 (RAB11A)
Exosome [BR:ocu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100009072 (RAB11A)
  Exosomal proteins of colorectal cancer cells
   100009072 (RAB11A)
GTP-binding proteins [BR:ocu04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab11/25 [OT]
    100009072 (RAB11A)
SSDB
Motif
Pfam: Ras Roc Arf MMR_HSR1 RsgA_GTPase AAA_22 GTP_EFTU AAA_16 PduV-EutP FeoB_N ABC_tran NTPase_1 Gtr1_RagA SRPRB TniB AAA_14 AAA_24 FAD-SLDH MCM AAA_5 AAA_21
Other DBs
NCBI-GeneID: 100009072
NCBI-ProteinID: NP_001075720
Ensembl: ENSOCUG00000014755
UniProt: P62493
LinkDB
Position
17
AA seq 216 aa
MGTRDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTI
KAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIM
LVGNKSDLRHLRAVPTDEARAFAEKNGLSFIETSALDSTNVEAAFQTILTEIYRIVSQKQ
MSDRRENDMSPSNNVVPIHVPPTTENKPKVQCCQNI
NT seq 651 nt   +upstreamnt  +downstreamnt
atgggcacccgcgacgacgagtacgactacctcttcaaagttgtgcttattggagattct
ggtgttggaaaaagtaatcttctatctcgatttactcgaaatgagtttaatctagaaagc
aagagcaccattggagtagaatttgcaacaagaagcatccaggttgatgggaaaacaata
aaagcacagatatgggacacggcagggcaagagcgataccgagctataacatcagcatac
tatcgtggagctgtaggtgccttattggtttatgacattgctaaacatctcacatatgaa
aatgtagagcggtggctgaaagaactgagagatcatgcggatagtaacattgttatcatg
ctcgtgggtaacaagagtgatttacgtcatctcagggcagttcctactgatgaagcaaga
gcttttgcagaaaagaatggtttgtcatttattgagacatctgctttagattctacaaat
gtagaagctgcttttcaaacaattctaacagagatataccgcattgtttctcagaagcag
atgtcagacagacgtgagaatgacatgtctccaagcaacaatgtggttcctattcatgtt
ccaccaaccactgaaaacaagccaaaggtgcagtgctgtcagaacatctaa

KEGG   Oryctolagus cuniculus (rabbit): 100358563
Entry
100358563         CDS       T03373                                 

Gene name
RAB11B
Definition
(RefSeq) RAB11B, member RAS oncogene family
  KO
K07905  Ras-related protein Rab-11B
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04144  Endocytosis
ocu04152  AMPK signaling pathway
ocu04962  Vasopressin-regulated water reabsorption
ocu05164  Influenza A
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    100358563 (RAB11B)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100358563 (RAB11B)
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    100358563 (RAB11B)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    100358563 (RAB11B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100358563 (RAB11B)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ocu04147]
    100358563 (RAB11B)
   04031 GTP-binding proteins [BR:ocu04031]
    100358563 (RAB11B)
Membrane trafficking [BR:ocu04131]
 Protein recycling
  Rab GTPases and associated proteins
   Rab GTPases
    100358563 (RAB11B)
Exosome [BR:ocu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100358563 (RAB11B)
  Exosomal proteins of other body fluids (saliva and urine)
   100358563 (RAB11B)
  Exosomal proteins of colorectal cancer cells
   100358563 (RAB11B)
GTP-binding proteins [BR:ocu04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab11/25 [OT]
    100358563 (RAB11B)
SSDB
Motif
Pfam: Ras Roc Arf MMR_HSR1 RsgA_GTPase AAA_22 GTP_EFTU AAA_16 ABC_tran AAA_14 PduV-EutP FeoB_N TniB SRPRB FAD-SLDH NTPase_1 MCM AAA_29 KAP_NTPase Gtr1_RagA AAA_7 AAA_21
Other DBs
NCBI-GeneID: 100358563
NCBI-ProteinID: XP_017193461
LinkDB
Position
Un
AA seq 248 aa
MGGQPGEPWAWSLLSSPASPRLLCSLCPSAALGQPCCTRHGAWVVLIGDSGVGKSNLLSR
FTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLV
YDIAKHLTYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRAVPTDEARAFAEKNNLSF
IETSALDSTNVEEAFKNILTEIYRIVSQKQIADRAAHDESPGNNVVDISVPPTTDGQKPS
KLQCCQSL
NT seq 747 nt   +upstreamnt  +downstreamnt
atgggagggcagcccggagagccctgggcctggtccctcctctccagcccggccagccca
cgcctgctctgctccctgtgtccctcagctgctttgggccagccctgctgcacacgtcat
ggcgcctgggtggtgctcatcggggactcaggcgtgggcaagagcaacctgctgtcgcgc
ttcacccgtaacgagttcaacctggagagcaagagcaccattggcgtggagttcgccacc
cgcagcatccaggtggacggcaagaccatcaaggcgcagatctgggacaccgccggccag
gagcgctaccgcgccatcacctccgcgtactaccgtggcgcagtgggcgctctgctggtg
tacgacattgccaagcacctgacctacgagaacgtggagcgctggctgaaggagctgcgg
gaccacgccgacagcaacatcgtcatcatgctggtcggcaacaagagcgacctgcgccac
ctgcgggccgtgcccacggatgaggcccgcgcctttgcagagaagaacaacctgtccttc
atcgagacctcagccttggattccaccaacgtagaggaagcattcaagaacatcctcaca
gagatctaccgcatcgtgtcacagaagcagatcgccgaccgcgccgcgcacgacgagtcc
cccggcaacaacgtggtggacatcagcgtgccgcccaccaccgacggacagaagcccagc
aagctgcagtgctgccagagcctgtga

DBGET integrated database retrieval system