KEGG   Oryctolagus cuniculus (rabbit): 100009553
Entry
100009553         CDS       T03373                                 

Gene name
ETF1, ERF1
Definition
(RefSeq) eukaryotic translation termination factor 1
  KO
K03265  peptide chain release factor subunit 1
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu03015  mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    100009553 (ETF1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ocu03019]
    100009553 (ETF1)
   03012 Translation factors [BR:ocu03012]
    100009553 (ETF1)
Messenger RNA biogenesis [BR:ocu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Surveillance complex
     100009553 (ETF1)
Translation factors [BR:ocu03012]
 Eukaryotic type
  Release factors
   100009553 (ETF1)
SSDB
Motif
Pfam: eRF1_2 eRF1_3 eRF1_1 acVLRF1 baeRF_family10 Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 100009553
NCBI-ProteinID: NP_001076236
Ensembl: ENSOCUG00000006650
UniProt: P62497
LinkDB
Position
3
AA seq 437 aa
MADDPSAADRNVEIWKIKKLIKSLEAARGNGTSMISLIIPPKDQISRVAKMLADEFGTAS
NIKSRVNRLSVLGAITSVQQRLKLYNKVPPNGLVVYCGTIVTEEGKEKKVNIDFEPFKPI
NTSLYLCDNKFHTEALTALLSDDSKFGFIVIDGSGALFGTLQGNTREVLHKFTVDLPKKH
GRGGQSALRFARLRMEKRHNYVRKVAETAVQLFISGDKVNVAGLVLAGSADFKTELSQSD
MFDQRLQSKVLKLVDISYGGENGFNQAIELSTEVLSNVKFIQEKKLIGRYFDEISQDTGK
YCFGVEDTLKALEMGAVEILIVYENLDIMRYVLHCQGTEEEKILYLTPEQEKDKSHFTDK
ETGQEHELIESMPLLEWFANNYKKFGATLEIVTDKSQEGSQFVKGFGGIGGILRYRVDFQ
GMEYQGGDDEFFDLDDY
NT seq 1314 nt   +upstreamnt  +downstreamnt
atggcggacgaccccagtgctgccgacaggaacgtggaaatctggaagatcaagaagctc
attaagagcttggaggcggcccgcggcaatggcaccagcatgatatcattgatcattcct
cccaaagaccagatttcccgagtggcaaaaatgttagcagatgaatttggaactgcatcc
aacattaagtcacgagtaaaccgcctttcagtcctgggagccattacatctgtacaacaa
agactcaaactttataacaaagtacctccaaatggtctggttgtttactgtggaacaatt
gtaacagaagaaggaaaggaaaagaaagtcaacattgactttgaacctttcaaaccaatt
aatacgtcattgtatttgtgtgacaacaaattccatacagaggctcttacagcactactt
tcagatgatagcaagtttggcttcattgtaatagatggtagtggtgcactttttggcaca
ctgcagggaaatacaagagaagtcctgcacaaattcactgtggatctcccaaagaaacac
ggtagaggaggtcagtcagccttgcgttttgcccgtttaagaatggaaaagcgacacaac
tatgttcggaaagtagcagagactgctgtacagctgtttatttctggggacaaagtgaat
gtggctggtctcgttttagctggatcagctgactttaaaactgaactaagtcaatctgat
atgtttgaccagaggttgcaatcaaaagttttaaaattagttgatatatcctatggcggt
gaaaatggattcaaccaagctattgagttatctactgaggtcctctccaacgtgaaattc
attcaagagaagaaattaataggacgatactttgatgaaatcagtcaagacacgggcaag
tactgttttggagttgaagatacgctaaaagctttggaaatgggagccgtagaaattcta
atagtctatgaaaatttggatataatgagatacgttcttcattgccaaggcacagaagag
gagaaaattctttacctaactccagaacaagagaaggataaatctcatttcacagacaaa
gagacaggacaggaacatgagctgattgagagcatgcccctgttggaatggtttgctaac
aactataaaaaatttggagctacattggaaattgtcacagataagtcacaagaaggatcc
cagtttgtgaaaggatttggtggaattggaggtatcttgcggtaccgagtagatttccag
ggaatggaatatcaaggaggagacgatgaattttttgaccttgatgactactag

DBGET integrated database retrieval system