KEGG   Oryctolagus cuniculus (rabbit): 100125985Help
Entry
100125985         CDS       T03373                                 

Gene name
CTNNB1
Definition
(RefSeq) catenin beta 1
  KO
K02105  catenin beta 1
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04015  Rap1 signaling pathway
ocu04310  Wnt signaling pathway
ocu04390  Hippo signaling pathway
ocu04510  Focal adhesion
ocu04520  Adherens junction
ocu04550  Signaling pathways regulating pluripotency of stem cells
ocu04670  Leukocyte transendothelial migration
ocu04916  Melanogenesis
ocu04919  Thyroid hormone signaling pathway
ocu04934  Cushing syndrome
ocu05100  Bacterial invasion of epithelial cells
ocu05160  Hepatitis C
ocu05163  Human cytomegalovirus infection
ocu05165  Human papillomavirus infection
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05200  Pathways in cancer
ocu05205  Proteoglycans in cancer
ocu05210  Colorectal cancer
ocu05213  Endometrial cancer
ocu05215  Prostate cancer
ocu05216  Thyroid cancer
ocu05217  Basal cell carcinoma
ocu05224  Breast cancer
ocu05225  Hepatocellular carcinoma
ocu05226  Gastric cancer
ocu05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
ocu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100125985 (CTNNB1)
   04310 Wnt signaling pathway
    100125985 (CTNNB1)
   04390 Hippo signaling pathway
    100125985 (CTNNB1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100125985 (CTNNB1)
   04520 Adherens junction
    100125985 (CTNNB1)
   04550 Signaling pathways regulating pluripotency of stem cells
    100125985 (CTNNB1)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    100125985 (CTNNB1)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    100125985 (CTNNB1)
   04916 Melanogenesis
    100125985 (CTNNB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100125985 (CTNNB1)
   05205 Proteoglycans in cancer
    100125985 (CTNNB1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100125985 (CTNNB1)
   05225 Hepatocellular carcinoma
    100125985 (CTNNB1)
   05226 Gastric cancer
    100125985 (CTNNB1)
   05216 Thyroid cancer
    100125985 (CTNNB1)
   05217 Basal cell carcinoma
    100125985 (CTNNB1)
   05215 Prostate cancer
    100125985 (CTNNB1)
   05213 Endometrial cancer
    100125985 (CTNNB1)
   05224 Breast cancer
    100125985 (CTNNB1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100125985 (CTNNB1)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    100125985 (CTNNB1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100125985 (CTNNB1)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    100125985 (CTNNB1)
  09172 Infectious disease: viral
   05160 Hepatitis C
    100125985 (CTNNB1)
   05163 Human cytomegalovirus infection
    100125985 (CTNNB1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100125985 (CTNNB1)
   05165 Human papillomavirus infection
    100125985 (CTNNB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arm Cnd1 Adaptin_N HEAT_2 HEAT_EZ KAP Atx10homo_assoc Arm_2 Queuosine_synth
Motif
Other DBs
NCBI-GeneID: 100125985
NCBI-ProteinID: XP_002713121
Ensembl: ENSOCUG00000001468
UniProt: G1SFH9
LinkDB All DBs
Position
9
AA seq 781 aa AA seqDB search
MATQADLMELDMAMEPDRKAAVSHWQQQSYLDSGIHSGATTTAPSLSGKGNPEEEDVDTS
QVLYEWEQGFSQSFTQEQVADIDGQYAMTRAQRVRAAMFPETLDEGMQIPSTQFDAAHPT
NVQRLAEPSQMLKHAVVNLINYQDDAELATRAIPELTKLLNDEDQVVVNKAAVMVHQLSK
KEASRHAIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPAL
VKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDC
LQILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEA
GGMQALGLHLTDPSQRLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLLGSDDINVVTCA
AGILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEM
AQNAVRLHYGLPVVVKLLHPPSHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLL
VRAHQDTQRRTSMGGTQQQFVEGVRMEEIVEGCTGALHILARDVHNRIVIRGLNTIPLFV
QLLYSPIENIQRVAAGVLCELAQDKEAAEAIEAEGATAPLTELLHSRNEGVATYAAAVLF
RMSEDKPQDYKKRLSVELTSSLFRTEPMAWNETADLGLDIGAQGEPLGYRQDDPSYRSFH
SGGYGQDALGMDPMMEHEMGGHHPGADYPVDGLPDLGHAQDLMEGLPPGDSNQLAWFDTD
L
NT seq 2346 nt NT seq  +upstreamnt  +downstreamnt
atggctactcaagctgatttgatggagttggacatggccatggagccagacagaaaagca
gctgttagtcactggcagcagcagtcttacctggactctggaatccattctggtgccacc
accacagccccttctctgagtggcaaaggcaatcccgaggaagaggatgtggatacctcc
caagtcctgtatgagtgggagcagggcttttctcagtccttcactcaagaacaagtagct
gatattgatgggcagtatgcaatgactcgagctcagagggtacgagctgccatgttccct
gagacattagatgagggtatgcagatcccatcgacacagtttgatgctgcccatcctact
aatgttcagcgtctggccgagccttcccaaatgctgaaacacgcagttgtcaacttgatt
aactatcaagatgatgcagaacttgccacacgtgcaatcccagaactgacaaaactgctc
aatgacgaggatcaggtggtggttaataaggctgcagttatggtccatcagctttctaaa
aaggaagcttccagacacgccatcatgcgttctcctcagatggtgtctgctattgtacgc
accatgcagaatacaaatgatgtggaaacggctcgctgtactgctggaaccttgcacaac
ctttcccatcatcgcgaaggcttgttagccatctttaagtctggaggcatccctgccttg
gtgaaaatgcttggctcacctgtggattctgtattgttttatgccattacaactctccac
aaccttttattgcatcaagaaggagctaaaatggcagtgcgtttagctggtgggctgcag
aaaatggttgccttgctcaacaaaacaaatgttaaatttttggctattacaacagactgc
cttcagattttagcttacggcaatcaagaaagcaagctgattattctggctagcggtgga
ccccaagctttagtaaatattatgaggacctacacttacgagaaactactgtggaccaca
agcagagtattgaaggtgctgtctgtgtgctctagtaataagccggctattgttgaagct
ggaggaatgcaagccttaggacttcacctgaccgatcctagtcaacgtctcgttcagaac
tgtctttggactcttaggaatctttcagatgctgcaactaaacaggaggggatggaaggg
cttcttgggactcttgttcagcttctgggttcagatgatataaatgtggtcacctgtgca
gccggaattctttctaacctcacttgcaataattataagaacaagatgatggtgtgccaa
gtgggtggtatagaggctcttgtgcgcaccgtccttcgtgctggggacagggaggacatc
acggagcctgccatctgtgctctccgtcatctgaccagccgacaccaggaagcggagatg
gcccagaatgctgttcgccttcactatggactgccagttgtggtgaagctcctgcacccg
ccatcccactggcctctgataaaggctactgttggattgattcgaaatcttgccctttgt
ccagccaatcatgcaccattgcgtgagcagggtgccattccacgcctagttcagttgctg
gttcgtgcacatcaggatacccagcgtcgcacatccatgggtggaacacagcagcagttt
gtggagggagtccgcatggaagaaatagtggaaggttgtacgggagcccttcacatccta
gctcgggatgttcataaccgaattgtaatcagaggactaaataccattccactgtttgtg
cagctgctctattctcccattgaaaatatccaaagagtagctgcaggggtcctctgtgaa
cttgctcaggacaaggaggctgcagaagcgattgaagcggagggagccacagcgcctttg
acagaattgcttcactctaggaatgaaggtgttgccacgtacgccgctgcggttttgttc
cgaatgtctgaggacaagccacaggattataagaagaggctttcggtggagctgaccagt
tctctcttcagaacagagccaatggcttggaatgagactgctgaccttggacttgatatt
ggcgcccagggagaaccccttggatatcgccaggatgatcccagttaccgttcctttcac
tctggtggatacggccaggatgccttgggtatggaccccatgatggagcatgagatgggt
ggccaccaccccggtgctgactacccagttgatgggctgccagacctggggcacgctcag
gacctcatggaggggctgcctccaggtgacagcaatcagctggcctggtttgatactgac
ctgtaa

DBGET integrated database retrieval system