KEGG   Oryctolagus cuniculus (rabbit): 100134864
Entry
100134864         CDS       T03373                                 

Gene name
CCNE1
Definition
(RefSeq) cyclin E1
  KO
K06626  G1/S-specific cyclin-E1
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04110  Cell cycle
ocu04114  Oocyte meiosis
ocu04115  p53 signaling pathway
ocu04151  PI3K-Akt signaling pathway
ocu04218  Cellular senescence
ocu04934  Cushing syndrome
ocu05161  Hepatitis B
ocu05162  Measles
ocu05165  Human papillomavirus infection
ocu05166  Human T-cell leukemia virus 1 infection
ocu05169  Epstein-Barr virus infection
ocu05200  Pathways in cancer
ocu05203  Viral carcinogenesis
ocu05206  MicroRNAs in cancer
ocu05215  Prostate cancer
ocu05222  Small cell lung cancer
ocu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100134864 (CCNE1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100134864 (CCNE1)
   04114 Oocyte meiosis
    100134864 (CCNE1)
   04115 p53 signaling pathway
    100134864 (CCNE1)
   04218 Cellular senescence
    100134864 (CCNE1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100134864 (CCNE1)
   05206 MicroRNAs in cancer
    100134864 (CCNE1)
   05203 Viral carcinogenesis
    100134864 (CCNE1)
  09162 Cancer: specific types
   05226 Gastric cancer
    100134864 (CCNE1)
   05215 Prostate cancer
    100134864 (CCNE1)
   05222 Small cell lung cancer
    100134864 (CCNE1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100134864 (CCNE1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100134864 (CCNE1)
   05161 Hepatitis B
    100134864 (CCNE1)
   05162 Measles
    100134864 (CCNE1)
   05169 Epstein-Barr virus infection
    100134864 (CCNE1)
   05165 Human papillomavirus infection
    100134864 (CCNE1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ocu03032]
    100134864 (CCNE1)
   03036 Chromosome and associated proteins [BR:ocu03036]
    100134864 (CCNE1)
DNA replication proteins [BR:ocu03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    100134864 (CCNE1)
Chromosome and associated proteins [BR:ocu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    100134864 (CCNE1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 100134864
NCBI-ProteinID: XP_002721192
Ensembl: ENSOCUG00000009143
UniProt: G1SWM6
LinkDB
Position
Un
AA seq 410 aa
MPRERKERDAKERGTMKDDGGSDFSVRSRKRKANVAVFLQDPDEQIAKIDRTVRGQCGSQ
PWDSDAVRADPCSSIPTPDKEEDEPVYANSTFDPHSLAPARASPLPVLNWANREEVWKIM
LNKEKKYLRDQHFLQRHPLLQPKMRAILLDWLMEVCEVYKLHRETFYLAQDFFDRYMATQ
ENIVKTLLQLIGISSLFIAAKLEEIYPPKLHQFAYVTDGACSGDEILTMELVIMKALKWH
LSPLTIVSWLNVYMQVAYLNDVCEVLLPQYPQQIFTQIAELLDLCVLDVGCLEFSYGVLA
ASALYHFSSSELMQKVSGYQWCDIEKCVKWMVPFAMVIRETGSSKLKHFRGVPAEDAHNI
QTHINSLDLLDKAQAKKAILSEQNRMSPLPTGVLTPPPSSKKQNSEQGTV
NT seq 1233 nt   +upstreamnt  +downstreamnt
atgccgagggagaggaaagagagggatgcgaaggaacggggcaccatgaaagacgacggc
ggcagcgacttctctgtccggtccaggaaaaggaaggcaaatgtggccgtttttttgcag
gatccagatgagcaaattgccaagattgacaggactgtgagaggccagtgcggcagtcag
ccttgggacagcgatgcagtacgtgcagacccctgctcctcgatccccacacccgacaag
gaagaggatgagccggtctacgccaactccacgtttgatcctcatagcttggcaccagcc
agagcttcgccgctgcctgttctgaactgggcaaatagagaggaggtctggaaaatcatg
ttaaacaaggaaaagaagtacttaagggatcagcactttctgcagcgacaccctcttctg
cagcctaaaatgcgagcgattcttctggactggctaatggaggtgtgtgaagtctataag
cttcacagggagacattttacttggcacaggatttctttgatcggtacatggccacacaa
gaaaatattgtaaaaacacttctacaacttattgggatctcatctttatttattgctgcc
aaactcgaggaaatctaccctccgaagctgcaccagtttgcttatgtcaccgacggggct
tgttcaggggacgagattcttaccatggaattagtgattatgaaggcccttaagtggcat
ttaagtcccctgaccattgtgtcctggctgaacgtctacatgcaggttgcgtacctgaat
gatgtgtgtgaggtgctactgccacagtatccccagcaaatcttcacacagattgcagag
cttttagatctctgtgtcctggatgtcggctgcctagaattttcctatggtgtcctcgct
gcctccgccttgtaccatttctcgtcatccgagttgatgcagaaggtgtcagggtatcag
tggtgtgacatcgagaagtgtgtcaagtggatggttccatttgccatggttataagagag
acaggaagctccaaactgaagcacttcaggggggttcccgccgaagacgcgcacaacata
cagacccacatcaacagcttggatttgctggacaaagcccaagcaaagaaagccatattg
tcggaacagaataggatgtcgcctctccccactggggtcctcacccccccaccgagcagt
aagaagcagaacagtgagcagggaacagtgtga

KEGG   Oryctolagus cuniculus (rabbit): 100134867
Entry
100134867         CDS       T03373                                 

Gene name
CCNE2
Definition
(RefSeq) cyclin E2
  KO
K06626  G1/S-specific cyclin-E1
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04110  Cell cycle
ocu04114  Oocyte meiosis
ocu04115  p53 signaling pathway
ocu04151  PI3K-Akt signaling pathway
ocu04218  Cellular senescence
ocu04934  Cushing syndrome
ocu05161  Hepatitis B
ocu05162  Measles
ocu05165  Human papillomavirus infection
ocu05166  Human T-cell leukemia virus 1 infection
ocu05169  Epstein-Barr virus infection
ocu05200  Pathways in cancer
ocu05203  Viral carcinogenesis
ocu05206  MicroRNAs in cancer
ocu05215  Prostate cancer
ocu05222  Small cell lung cancer
ocu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100134867 (CCNE2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100134867 (CCNE2)
   04114 Oocyte meiosis
    100134867 (CCNE2)
   04115 p53 signaling pathway
    100134867 (CCNE2)
   04218 Cellular senescence
    100134867 (CCNE2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100134867 (CCNE2)
   05206 MicroRNAs in cancer
    100134867 (CCNE2)
   05203 Viral carcinogenesis
    100134867 (CCNE2)
  09162 Cancer: specific types
   05226 Gastric cancer
    100134867 (CCNE2)
   05215 Prostate cancer
    100134867 (CCNE2)
   05222 Small cell lung cancer
    100134867 (CCNE2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100134867 (CCNE2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100134867 (CCNE2)
   05161 Hepatitis B
    100134867 (CCNE2)
   05162 Measles
    100134867 (CCNE2)
   05169 Epstein-Barr virus infection
    100134867 (CCNE2)
   05165 Human papillomavirus infection
    100134867 (CCNE2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ocu03032]
    100134867 (CCNE2)
   03036 Chromosome and associated proteins [BR:ocu03036]
    100134867 (CCNE2)
DNA replication proteins [BR:ocu03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    100134867 (CCNE2)
Chromosome and associated proteins [BR:ocu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    100134867 (CCNE2)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 100134867
NCBI-ProteinID: XP_002710743
Ensembl: ENSOCUG00000005398
UniProt: G1SNU7
LinkDB
Position
3
AA seq 405 aa
MSRRSSRLQAKQQSQPSQTDSPQEAQIIQAKKRKTAQDVKKRKEEKVTKKHQYEIRNCWP
PVLSGGISPCIIIETPHKEIGTSDFSRFTNYRFTNLFINPSPLPDLSWGCSKEVWLNMLK
KESRYVHDKHFEVLHSDLEPQMRSILLDWLLEVCEVYTLHRETFYLAQDFFDRFMLTQKD
INKNMLQLIGITSLFIASKLEEIYAPKLQEFAYVTDGACSEEDILRMELIILKALKWELC
PVTVISWLNLFLQVDALKDAPKVLLPQYSQETFIQIAQLLDLCVLAVDSLEFQYRILAAA
ALCHFTSIQVVKKASGLEWDNISECVDWMVPFVSVIKSTCPVKLKTFKKIPVEDRHNIQT
HTNYLAMLDEVNYVNSFRKGGQLSPVCSGGIMTPPKSTEKPPGKH
NT seq 1218 nt   +upstreamnt  +downstreamnt
atgtcaagacgcagtagccgtttacaagctaagcagcagtcccagcccagtcagacggat
tccccacaagaagcccagataatccaagccaagaagagaaaaacagcccaggatgtcaaa
aagagaaaagaggaaaaggtcaccaagaaacatcagtatgagattaggaattgctggcca
cctgtattatctgggggaatcagtccttgcattattattgaaacaccccataaagaaata
ggaacaagcgacttctccagatttacaaattacagattcacaaatctttttattaatcct
tcacctttgcctgatttaagctggggatgttcaaaagaggtgtggctaaacatgttaaaa
aaggaaagcaggtatgttcatgacaagcattttgaagttctgcattctgacctggaacca
caaatgaggtcaatacttctagactggcttttagaggtatgtgaagtatacacacttcac
agagaaacattttatcttgcacaagacttttttgatagatttatgttgacacaaaaggat
ataaataaaaatatgcttcaactcattgggattacctcattattcattgcttccaaactt
gaggaaatctatgctcctaaactccaagagtttgcttatgtcactgatggtgcttgcagt
gaagaggatatcttaaggatggaactcattatattaaaggctttaaaatgggaactatgt
cctgtaacagtcatctcctggctaaatctttttcttcaagttgatgctcttaaagatgct
cctaaagttcttctacctcagtattctcaggaaacattcattcaaatagctcagctttta
gatctgtgtgttctagctgtggattcattagaattccagtataggatactggccgctgct
gccctgtgccacttcacctccatccaagtggttaagaaagcctcaggtttggaatgggac
aacatttcagaatgtgtagactggatggtgccttttgttagtgtcataaaaagtacgtgt
ccagtgaagctgaagacttttaagaagattcctgtggaagacagacataatatccaaaca
catacaaattatttggctatgctggatgaagtaaattatgtaaactccttcagaaaaggg
ggacagttgtcaccagtgtgcagtggaggcattatgacaccaccgaagagcactgaaaaa
ccaccaggaaaacactaa

DBGET integrated database retrieval system