KEGG   Oryctolagus cuniculus (rabbit): 100338262
Entry
100338262         CDS       T03373                                 

Gene name
ACIN1
Definition
(RefSeq) apoptotic chromatin condensation inducer 1
  KO
K12875  apoptotic chromatin condensation inducer in the nucleus
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu03013  RNA transport
ocu03015  mRNA surveillance pathway
ocu03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    100338262 (ACIN1)
  09122 Translation
   03013 RNA transport
    100338262 (ACIN1)
   03015 mRNA surveillance pathway
    100338262 (ACIN1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ocu03019]
    100338262 (ACIN1)
   03041 Spliceosome [BR:ocu03041]
    100338262 (ACIN1)
Messenger RNA biogenesis [BR:ocu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    EJC complex
     100338262 (ACIN1)
Spliceosome [BR:ocu03041]
 Complex C
  Other components
   EJC/TREX
    100338262 (ACIN1)
SSDB
Motif
Pfam: RSB_motif SAP RRM_1
Other DBs
NCBI-GeneID: 100338262
NCBI-ProteinID: XP_008267582
Ensembl: ENSOCUG00000001678
LinkDB
Position
17
AA seq 1295 aa
MPEAVGTDPSTSRKMAELEEVTLDGKPLQALRVTDLKAALEQRGLAKSGQKSALVKRLKG
ALMLENLQKHSTPHAAFQPNSQIGEEMSQNSFIKQYLEKQQELLRQRLEREAREAAELEE
ASAESEDEMIHPEGVASLLPPDFQSSLERPELELSRHSPRKGSSVSEEKGESDDEKPRKG
ERRSSRVRQARAAKVSECTAEEEDQETPSRNLRVRADRNLKTEEEEEEEEDEEEDEEEED
DDNEGQKPREVPILKQFEEEEGEEMARATPEEVMDERHKTVRSQEQEGLERGGRVTRSQE
EARKSHLARQQQEREMKTASPLEEEEREIKSSQNLEEKSKSPSPPRLTEDLEKAPLVLQP
ELTVSEEETPPPLLTKEASSPPPRAQLQSEEIEPMEGPAPPVLIQLSPPNTDAENRELLV
AQHPVQLVGSLSPLSSPADTKAESPTEKVPEESALPLGQRSTLAQYPTQKALETDSEKSA
QPLPLKIQELTPAKGITEQSVRQLSLEQKEGRRASHPLLLGHRLKQSADSSSSRSSSSSS
SSSRSRSRSPDSSGSPSHSPPRSKQRDVSQAHVHTNPRGRPKMDSRSTSESRSRSRSRSR
SASSNSRKSLSPGVSRDSSTSFMETKDPSSGQEIATPPVPQLQVLEPKERTSASSSSIHV
RHLSQPEPAEKHVTQRLQPERGSPKKCEAEEAEPPAATQPQTSETQTSHLPESGRIQHTV
EEKEEVTMDTSESRPENDVPELPMPIADQVSNDDRPEGSAEDEEKKESSLPKSFKRKISV
VSATKGVPAGNSDTEGGQPGRKRRWGASTATTQKKPSISITTESLKSLIPDIKPLAGQEA
VVDLHADDSRISEDETERNGDDGTHDKGLKICRTVTQVVPAEGQENGQREEEEEEKEPEA
EPPVPPQVSVEVALPPPVEHEVKKVTLGDTLTRRSISQQKSGVSITIDDPVRTAQVPSPP
RGKISNIVHISNLVRPFTLGQLKELLGRTGTLVEEAFWIDKIKSHCFVTYSTVEEAVATR
TALHGVKWPQSNPKFLCADYAEQEELDYHRGLLVDRPSETKAEEQGVPRPLHPPPPPPVQ
PPQHPRAEQREQERAVREQWAEREREMERRERTRSEREWDRDKVREGPRSRSRSRDRRRK
ERAKSKEKKSEKKEKAQEEPPAKLLDDLFRKTKAAPCIYWLPLTDSQIVQKEAERAERAK
EREKRRKEQEEEEQKEREKEAERERTRQLEREKRREHSRERERERERERERDRGDRDRDR
ERDRDRGRERDRRDTKRHSRSRSRSTPVRDRGGRR
NT seq 3888 nt   +upstreamnt  +downstreamnt
atgcccgaagccgtcgggacggacccgagtacctcacgcaagatggcggagctggaggag
gtgactctggacgggaagcctcttcaggcgctgcgggtgaccgacctgaaggccgcactg
gagcagcgaggcctagccaagagcgggcagaagagtgccctggtcaagcggctcaaaggg
gctctaatgctagaaaatttacagaaacactcaacaccccatgctgcattccagccaaat
tcccagattggcgaggaaatgagccagaacagtttcataaagcagtatctggaaaagcag
caggagctacttaggcagcgtctggaacgtgaagctcgagaagctgcagaacttgaagaa
gcttcagctgagtcggaggacgagatgatccatcctgagggagtggcttccctgctgcct
cctgactttcagagcagcttggagagaccagagctggaactcagcagacattcgcccaga
aaaggctcctctgtttctgaagagaaaggtgaatctgatgatgagaaaccaaggaaagga
gaaagacggtcatccagggtgagacaggcaagagctgcaaaagtctctgagtgcactgct
gaggaggaagatcaagaaacaccttctagaaatctgagggttagagcagatcgaaatttg
aaaacagaggaggaagaggaagaagaggaagatgaggaggaagatgaagaagaggaagat
gatgataatgagggacaaaaacctagggaagtaccaatcttaaaacagtttgaggaagaa
gagggggaagagatggccagagcaacaccagaagaggtaatggatgaaagacacaaaact
gtaaggtcccaggaacaggagggtttagagagaggaggaagagttacaagatcccaggaa
gaagccagaaaaagtcatctagccagacagcagcaggaaagagagatgaagacagcgtct
ccccttgaggaagaagaaagagaaataaaatcttcacaaaacttggaggaaaaatccaaa
tcgccttcccctcctcgactgactgaagatctcgagaaagcccctcttgtgctgcagcca
gagctaacagtcagtgaggaggaaactcccccacctttacttaccaaggaagcatcttct
ccaccacctcgtgcacaactccagagtgaagaaatcgagcccatggaaggcccagcaccc
cctgtcctcattcagttatctcctcctaatacagatgctgagaacagggagctgttagta
gctcagcatcctgtccagttggtgggaagcctgtctcctttgtcaagtcctgcagacacc
aaagcagaatctcccacagagaaagtgccagaggagagtgccctgcctctaggtcagagg
agcacactggctcagtacccaacccagaaggctcttgaaactgactcagaaaaatctgct
cagccactccctctaaaaatccaggaattaacaccggccaagggaatcacagagcagtct
gtgaggcagctgtccttggaacagaaggaaggcagaagggcttctcaccctcttctgctg
gggcacagattgaaacagtcagctgattcatcctctagccgctcgtcctcatcttcatcc
tccagttctaggtccagatctcgctctcctgacagttcaggctctccatctcactcacct
ccgaggtccaagcagagagatgtatcccaggcacatgttcacaccaaccctcgtggtaga
cccaagatggactccagatcaacatcagagtcccggtcccggtcccggtcccggtcccgt
tcagcatcaagcaacagcagaaaatcactgagccctggagtctccagggacagcagcacc
agcttcatggaaaccaaagatccctcttctggtcaggagattgcaactccaccagtgcca
caactacaggtccttgagccaaaggagaggacttccgcctcctcatcctctatccatgtg
aggcatctgagccagcctgagccagcggaaaagcatgtgacccagaggttacagcctgag
cgggggagcccaaagaagtgtgaagctgaagaggcagagccaccagctgccacacagccc
cagacctcagagactcagacctctcatctaccagaatcaggaaggattcagcacactgtt
gaggagaaggaggaagtgaccatggacacaagtgagagcagacctgaaaatgacgtcccg
gagcttcctatgcctattgcagaccaagtcagtaatgatgaccgcccagagggcagtgct
gaagatgaggagaagaaagagagctcgctgcccaaatcattcaagaggaagatctccgtt
gtctcagcgaccaagggggtgccagctggaaacagtgacacagaggggggccagcctggt
cggaagcgacgttggggagccagcacagccaccacacagaagaaaccctccatcagtatc
accaccgaatcgctgaagagcctcatccccgacatcaaacccctggcggggcaggaggct
gttgtggatcttcacgcggatgactcccgcatctccgaggatgagacggagcggaatggc
gacgacgggacccacgacaagggactgaagatatgccggactgtcactcaggtagtaccc
gccgagggccaggagaacgggcagcgggaagaagaggaagaggagaaggagcctgaagca
gagccccctgtgcctccgcaggtgtcagtagaggtggccttgcccccgcctgtggagcat
gaagtcaagaaagtgactctaggagacaccttaactcgacgctccattagccagcagaag
tccggagtttccatcactatcgatgacccagtccgaaccgcgcaggtgccctccccgccc
cggggcaagattagtaacattgtgcatatctccaatttggttcgacccttcactctaggc
cagctgaaggaattactgggccgcacaggaaccttggtggaggaggccttctggattgac
aagatcaaatctcactgctttgtcacgtactcaacagtagaggaagcagttgccacccgc
acagctctgcatggggtcaaatggccccagtccaatccgaaattcctttgtgctgactat
gctgagcaagaagagctggattatcaccggggtctcttggtggaccgtccctctgagacc
aaggcagaggagcagggagtaccacggcccctacacccccctcccccacccccagtccag
ccaccacagcacccccgggcagaacagcgggaacaggagcgggcagtgcgggagcagtgg
gcagagcgggaacgagaaatggagcgacgggaacgaactcgatcggagcgtgaatgggat
cgagacaaagttcgggaggggccacgttcccgatcgcggtcccgtgaccgccgccgcaag
gaacgtgcaaaatctaaagagaagaagagtgagaaaaaagagaaggcccaggaggagccg
cctgccaagctactggacgaccttttccgtaagaccaaggcggccccctgcatctattgg
ctcccgctgactgacagtcagatcgttcagaaggaggcagagcgggctgaacgggccaag
gagcgggagaaacggcgaaaggagcaggaagaagaggagcagaaggagcgggagaaggaa
gccgagcgggagcggacccggcagctggagcgggagaagaggcgggagcacagcagggag
agggagcgggagcgcgagcgggagcgggagcgcgacaggggggaccgagaccgagacagg
gagcgggaccgagacagaggccgggagcgggaccgcagagacaccaagcgccacagcaga
agccggagtcggagcacccctgtgcgggaccggggtgggcgccgctag

DBGET integrated database retrieval system