KEGG   Oryctolagus cuniculus (rabbit): 100338746
Entry
100338746         CDS       T03373                                 

Gene name
HBS1L
Definition
(RefSeq) HBS1 like translational GTPase
  KO
K14416  elongation factor 1 alpha-like protein
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu03015  mRNA surveillance pathway
ocu05134  Legionellosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    100338746 (HBS1L)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05134 Legionellosis
    100338746 (HBS1L)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ocu03019]
    100338746 (HBS1L)
Messenger RNA biogenesis [BR:ocu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Other transport factors
     100338746 (HBS1L)
SSDB
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 HBS1_N GTP_EFTU_D2 MMR_HSR1 AAA_22 AAA_29 DUF1296
Other DBs
NCBI-GeneID: 100338746
NCBI-ProteinID: XP_008261765
Ensembl: ENSOCUG00000011619
LinkDB
Position
12
AA seq 684 aa
MARHRNVRGYNYDEDFEDDDYYGQSVEDDYCISPSTAAQFIYSRRDKPSVVEPVEEYDSE
ELKQSSNSLSNHQLSGIDQARLYSCLDHMREVLGDAVPDEILIEAILKNKFDVQKALAVV
LEQDNLPNLKDKRERVVTTGKTAKGKSVSSQASRSESEIVPKVAKMTVSGKKQTMGFEVP
GVTSQENGHGFHTPQKGDDTSSAASGGGLEHTAKSAPAPHTGQVSEEQSSPAALVKKPGR
LRQQIDVKAELEKRQGGKQLLNLVVIGHVDAGKSTLMGHMLYLLGNVNKRTMHKYEQESK
KAGKASFAYAWVLDETGEERERGVTMDVGMTKFETTTKVITLMDAPGHKDFIPNMITGAA
QADVAVLVVDASRGEFEAGFETGGQTREHGLLVRSLGVTQLAVAVNKMDQVNWQQERFQE
ITGKLGHFLKQAGFKESDVAFIPTSGLSGENLITRSQSSELTKWYKGLCLLEHIDSFKPP
QRSIDKPFRLCVSDVFKDQGSGFCVTGKIEAGYIQTGDRLLAMPPNETCTAKGITLHDEP
VDWAAAGDHVSLTLVGMDIIKINVGCIFCGPKEPIKACTRFRARILIFNIEIPITKGFPV
LLHYQTVSEPAVIKRLISVLNKSTGEVTKKKPKLLTKGQNALVELQTQRPIALELYKDFK
ELGRFMLRYSGSTIAAGVVTEIKE
NT seq 2055 nt   +upstreamnt  +downstreamnt
atggcccgacatcggaatgtcagaggctataactacgatgaagattttgaagatgatgat
tattatggccagtctgtggaggatgattactgtatttctccatcaacagctgctcaattt
atttactcacgacgtgacaaaccttcagttgttgagcctgtagaagaatatgattctgaa
gaactgaaacaatcttccaactctctttcaaaccatcagctaagtggaattgatcaagct
cgtctttattcatgccttgatcacatgagagaggtacttggagatgctgtgccagatgaa
atactcatagaagcaattctgaagaacaagtttgatgtgcagaaggctttggcggtggtt
ctggaacaagataacctaccgaatttgaaggacaagagagagagagtagtaactacggga
aagacagcaaaaggaaaatcagtaagttcccaggcatctcgaagtgaatctgaaattgtg
ccaaaagttgctaaaatgactgtatctggaaagaagcaaactatgggatttgaagtgcct
ggagtaacttcccaagagaacggtcatggtttccacacacctcagaaaggtgacgatacc
agcagtgctgcttctggtggcggtctggagcacacggcgaaatccgctcccgcgcctcac
acggggcaggtgtcggaagaacagagctccccggcggcgctggtgaagaagcccggcagg
ctgcggcagcaaatcgatgtgaaagccgaactggagaagcggcaaggagggaagcagctc
ctcaacttagtggtcattggtcatgttgatgctgggaaaagtactctgatgggccatatg
ctttatctcctgggtaatgtaaacaaaagaactatgcataagtatgaacaggaatctaaa
aaggctggcaaagcttcgtttgcatatgcatgggtcttggatgagactggtgaagaaaga
gaaaggggagtgacaatggatgttggtatgacaaagtttgaaaccacaaccaaagttatt
acattaatggatgctccaggccataaggattttattcccaatatgattacaggagcagcc
caggcagatgtagctgtattagttgtagatgccagcaggggggagtttgaagctggattt
gagactggaggccagacacgagagcatggccttctggtccgatctcttggagtgacacag
cttgcagttgcggtcaacaaaatggatcaggttaattggcagcaagaaaggtttcaagaa
attactggaaaacttgggcactttcttaagcaagcaggttttaaggagagtgatgtagct
tttatccctacaagtggtctcagtggtgaaaacctaatcacaagatctcagtcaagtgag
ctcacaaagtggtataaaggactatgtttattagaacacattgattccttcaagcctcct
caacgatccattgataagccttttagattatgtgtgtctgatgttttcaaagatcaagga
tctggattttgtgtgactggtaaaattgaagctggttatatccagactggtgaccgacta
ctagcaatgcctccaaatgaaacttgcactgcaaaaggaatcactctgcatgatgaacct
gtcgactgggctgcagcgggtgaccatgttagccttactttggttgggatggatatcatc
aaaatcaatgttggctgcatattttgtggtcccaaagaaccgattaaagcttgtactcgt
ttcagagcccgaatcctcatctttaatattgaaattcctatcactaaaggatttcctgtg
ctgttacactaccagactgtcagtgaacctgctgtgatcaaacgcttgattagcgtcttg
aacaaaagcaccggtgaagtcacgaagaagaagcccaagttgttgactaaaggccagaat
gcattggtggaactacagacacaaagaccaatagcactggagctgtataaggactttaag
gagctggggaggtttatgctacgctacagtggttctacgatagctgctggtgtcgtcact
gagataaaagaatga

DBGET integrated database retrieval system