KEGG   Oryctolagus cuniculus (rabbit): 100339047
Entry
100339047         CDS       T03373                                 

Gene name
CSTF3
Definition
(RefSeq) cleavage stimulation factor subunit 3
  KO
K14408  cleavage stimulation factor subunit 3
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu03015  mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    100339047 (CSTF3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ocu03019]
    100339047 (CSTF3)
Messenger RNA biogenesis [BR:ocu03019]
 Eukaryotic type
  mRNA processing factors
   3' end processing
    Cleavage stimulation factor (CSTF) complex
     100339047 (CSTF3)
SSDB
Motif
Pfam: Suf TPR_14 NRDE-2 TPR_6 TPR_19 TPR_16
Other DBs
NCBI-GeneID: 100339047
NCBI-ProteinID: XP_002709085
Ensembl: ENSOCUG00000015417
UniProt: G1T9E3
LinkDB
Position
1
AA seq 717 aa
MSGDAATEQAAEYVPEKVKKAEKKLEENPYDLDAWSILIREAQNQPIDKARKTYERLVAQ
FPSSGRFWKLYIEAEIKAKNYDKVEKLFQRCLMKVLHIDLWKCYLSYVRETKGKLPSYKE
KMAQAYDFALDKIGMEIMSYQIWVDYINFLKGVEAVGSYAENQRITAVRRVYQRGCVNPM
INIEQLWRDYNKYEEGINIHLAKKMIEDRSRDYMNARRVAKEYETVMKGLDRNAPSVPPQ
NTPQEAQQVDMWKKYIQWEKSNPLRTEDQTLITKRVMFAYEQCLLVLGHHPDIWYEAAQY
LEQSSKLLAEKGDMNNAKLFSDEAANIYERAISTLLKKNMLLYFAYADYEESRMKYEKVH
SIYNRLLAIEDIDPTLVYIQYMKFARRAEGIKSGRMIFKKAREDTRTRHHVYVTAALMEY
YCSKDKSVAFKIFELGLKKYGDIPEYVLAYIDYLSHLNEDNNTRVLFERVLTSGSLPPEK
SGEIWARFLAFESNIGDLASILKVEKRRFTAFKEEYEGKETALLVDRYKFMDLYPCSASE
LKALGYKDVSRAKLAAIIPDPVVAPSIVPVLKDEVDRKPEYPKPDTQQMIPFQPRHLAPP
GLHPVPGGVFPVPPAAVVLMKLLPPPICFQGPFVQVDELMEIFRRCKIPNTVEEAVRIIT
GGAPELAVEGNGPVESNAVLTKAIKRPNEDSDDDEEKGAVVPPVHDIYRARQQKRIR
NT seq 2154 nt   +upstreamnt  +downstreamnt
atgtctggagacgcagccacggagcaggcagctgagtatgtcccagagaaggtgaagaaa
gctgaaaagaaattagaagagaatccatatgaccttgatgcttggagcattctcattcga
gaggcacagaatcaacctatagacaaagcacggaagacttatgaacgccttgttgcccag
ttccccagttctggcagattctggaaactgtacattgaagcagagattaaagctaaaaat
tatgacaaggtcgaaaagctatttcagagatgccttatgaaggttttgcacattgattta
tggaagtgttacctttcatatgtccgagaaaccaagggtaaactaccgagttacaaagaa
aaaatggctcaagcttatgattttgcactggataaaattggaatggaaattatgtcctat
cagatttgggtggattacatcaatttcttaaaaggcgtggaagctgttggatcttatgca
gaaaaccagagaataacagctgtccgaagagtttatcaacgaggttgtgtaaacccaatg
atcaacattgaacaactctggagagactataacaagtatgaagagggtatcaatattcat
ttagctaaaaaaatgattgaagatcggagtagagattacatgaatgctagacgtgtagcg
aaggaatatgagactgtaatgaaaggtttggatcgcaatgctccctcagtgcctcctcag
aatactcctcaagaagcgcagcaggtggatatgtggaagaagtacatacagtgggagaag
agcaaccctcttcgcacagaggaccagacccttataacaaagagagttatgtttgcttat
gaacagtgcctacttgtgctgggccatcatcctgatatttggtatgaagctgcccagtat
cttgagcaatcaagtaaactgctcgcagagaagggggatatgaataatgccaaattattt
agtgatgaagctgctaatatatatgaaagggccataagcactttattgaagaagaatatg
cttctatattttgcatatgcagattatgaagagagtcgcatgaagtatgagaaggtccac
agtatatataacagacttctggcaattgaggatattgacccaaccttggtatatatccaa
tatatgaaattcgcaaggagagcagaaggtatcaaatctggaagaatgatatttaaaaaa
gcaagagaagacaccagaactcgccaccatgtctatgttactgcagcactcatggaatat
tactgtagtaaggacaaatcagttgcctttaagatttttgagctggggctaaagaaatat
ggagatattccagaatatgtcctggcctatattgactatctctctcacctcaatgaggac
aataacacccgagttctgtttgaacgagttttaacatctggaagccttcctccagagaag
tctggagaaatctgggcccggtttctagcttttgaaagtaatattggtgacctagccagt
atactcaaagtggagaaaagaagatttacagccttcaaagaagagtatgagggcaaagaa
acggctttgctggtagacagatacaagttcatggatttatatccttgctctgccagtgag
ctgaaagcgctgggttacaaggatgtttcccgtgctaagctagcagctataattccagac
ccagttgtagctccttctatagtgcctgtcctgaaagatgaagtggacagaaaaccagaa
taccctaagccagacactcagcagatgattccatttcagccacggcatttagcacctcca
ggcttgcaccctgtccctggtggagtgttccctgtcccccctgcagccgtcgttttaatg
aaacttctccctcctcctatctgtttccagggtccttttgtacaagtggatgaactgatg
gaaattttccgaagatgcaagataccaaacactgtcgaggaagctgtgaggatcattact
ggaggggccccagagctggctgtagaaggcaacggcccagtggaaagtaacgcagtgctc
accaaggccatcaagaggcccaacgaggactcggatgacgatgaagaaaagggagctgtc
gtcccccccgttcacgacatttacagagcgcggcagcagaagcggatccgatga

DBGET integrated database retrieval system