KEGG   Oryctolagus cuniculus (rabbit): 100339760
Entry
100339760         CDS       T03373                                 

Gene name
PNN
Definition
(RefSeq) pinin, desmosome associated protein
  KO
K13114  pinin
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu03013  RNA transport
ocu03015  mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    100339760 (PNN)
   03015 mRNA surveillance pathway
    100339760 (PNN)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ocu03019]
    100339760 (PNN)
   03041 Spliceosome [BR:ocu03041]
    100339760 (PNN)
Messenger RNA biogenesis [BR:ocu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    EJC complex
     100339760 (PNN)
Spliceosome [BR:ocu03041]
 Complex C
  Other components
   EJC/TREX
    100339760 (PNN)
SSDB
Motif
Pfam: Pinin_SDK_N Pinin_SDK_memA
Other DBs
NCBI-GeneID: 100339760
NCBI-ProteinID: XP_002718204
Ensembl: ENSOCUG00000002176
UniProt: G1SGZ7
LinkDB
Position
17
AA seq 735 aa
MAVAVRTLQEQLEKAKESLKNVDENIRKLTGRDPNDVRPIQARLLALSGPGGGRGRGNLL
LRRGFSDSGGGPPAKQRDLEGAVSRLGGERRTRRESRQESDPEDDDVKKPALQSSVVATS
KERTRRDLIQDQNMDEKGKQRNRRIFGLLMGTLQKFKQESTVATERQKRRQEIEQKLEVQ
AEEERKQVENERRELFEERRAKQTELRLLEQKVELAQLQEEWNEHNAKIIKYIRTKTKPH
LFYIPGRMCPATQKLIEESQRKMNALFEGRRIEFAEQINKMEARPRRQSMKEKEHQVVRN
EEQKAEQEEGKVAQREEEMEETGNQHNDVEIEEAGEEEEKEVGVVHSDAEKEQEEEEQKQ
EVEVKMEEEPEVRESEKQQDSQPEEVMDVLEMVENVQNVIAEQEAMETNQVESTEPSENE
TSKELEPEMEFEVEPDKESKSLSPEKESVGALEIEKESEGKEEKEPEPQPEPVAQPQTQP
QPQPQIQTQPQPQLQPQSQPQPQLQPQTQPQPQSVLQPQPETLPAAVLQPPPQVIQEQGH
LLPERKEFPVESVKLTEVPIEPVLTAHPESKSKTKTRSRSRGRARNKTSKSRSRSSSSSS
SSSSSTSSSSGSSSSSGSSSSRSSSSSSTSTSGSSSRDSSSSTTSSSESRSRSRGRGHNR
DRKHRRSVDRKRRDTSGLERSHKSSKGGSSRDTKGSKDKNSRSDRKRSISESSRSGKRSS
RSERDRKSDRKDKRR
NT seq 2208 nt   +upstreamnt  +downstreamnt
atggcggtcgcagtgagaactttgcaggagcagctagaaaaggccaaagagagcctaaag
aacgtagatgagaatatccgcaagctcaccgggcgagatcccaatgacgtgaggcccatc
caagccaggttgctggccctttctggtcctggtggaggtagaggacgtggtaatttattg
ctgaggcgtggattctcagatagtggaggaggacccccagccaaacagagagaccttgaa
ggggcagtcagtaggctgggcggggagcgtcggacaagaagagaatcacgccaagaaagc
gacccagaggatgatgatgttaaaaagccagcgttgcagtcttcagttgtagctacctcc
aaagagcgtacacgtagagaccttatccaggatcaaaatatggatgaaaagggaaagcaa
aggaaccgacgaatatttggcttgttgatgggcacccttcaaaaatttaaacaggaatcc
actgttgccactgaaaggcaaaagaggcgccaggaaattgaacagaaacttgaagttcag
gctgaagaagagagaaagcaggttgaaaatgagaggcgagagctgtttgaagagagacgt
gctaaacaaacagaactgcggcttttggaacagaaggttgagcttgcacagctgcaagaa
gagtggaatgagcataatgccaagataattaaatatataagaactaagacaaagccccat
ttgttctatattcctggaagaatgtgtccagctacccaaaaactaatagaagagtcacag
agaaaaatgaatgctttatttgaaggtagacgcatcgaatttgcagaacaaataaataaa
atggaggctaggcctagaagacaatcaatgaaggaaaaagagcatcaagtggtgcgtaat
gaagagcagaaggcggaacaagaagagggtaaggtggctcagcgagaggaagagatggag
gagacaggtaatcagcacaatgatgtagaaatagaggaagcaggagaggaagaagaaaag
gaagtaggtgtagtgcatagtgatgcagagaaagaacaggaggaggaggaacagaaacag
gaagtggaggttaagatggaggaggaacctgaagtgagggaaagtgagaagcagcaggac
agtcagcctgaggaagttatggatgtgctggagatggttgagaatgttcaaaatgtgatc
gctgagcaagaggccatggaaacgaatcaagttgaaagtacagagccttcagaaaatgaa
actagcaaagagttagagccagaaatggaatttgaggttgagccagataaagaatctaag
tctctttctcctgaaaaagagagtgttggtgctctggaaatagagaaggagtctgaggga
aaagaagagaaagaacctgagccccagcctgagcctgtggcgcagcctcagacccagccc
cagccccagccccaaatccagacccagcctcagcctcagctccagccccagtctcagcct
cagcctcagctccagccccagactcagccccagccccaatctgtactgcagcctcagcct
gaaactttaccagcagcagttttacagccaccacctcaggttattcaggagcaagggcat
ttactccctgagagaaaggagtttcctgtagagtctgtaaagctcactgaggtgccaata
gagccagtcttaacagcacatccagaaagcaaaagcaaaaccaaaactaggagcagaagt
cgaggtcgagctagaaataaaacaagcaagagcagaagtcgaagcagtagcagtagtagt
tctagtagcagttcaaccagtagcagcagcggaagcagttctagcagtggcagcagtagt
agtcgaagcagttctagtagcagcaccagtacaagtggcagcagcagcagagacagtagc
agcagcactactagtagcagtgagagtagaagtcgaagtaggggccggggacataacaga
gatagaaagcacagaaggagtgtggatcggaagcgaagggatacttcaggtctagaaaga
agtcacaaatcttcaaaaggtggtagtagtagagatacaaaaggatcaaaggataagaat
tcccggtccgacagaaagaggtctatatcagagagtagtcgatcaggcaaaagatcttca
agaagtgaaagagaccgaaaatcagacaggaaagacaaaaggcgttaa

DBGET integrated database retrieval system