KEGG   Oryctolagus cuniculus (rabbit): 100339765
Entry
100339765         CDS       T03373                                 

Gene name
AXIN2
Definition
(RefSeq) axin 2
  KO
K04385  axin 2
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04310  Wnt signaling pathway
ocu04390  Hippo signaling pathway
ocu04550  Signaling pathways regulating pluripotency of stem cells
ocu04934  Cushing syndrome
ocu05010  Alzheimer disease
ocu05022  Pathways of neurodegeneration - multiple diseases
ocu05165  Human papillomavirus infection
ocu05200  Pathways in cancer
ocu05210  Colorectal cancer
ocu05213  Endometrial cancer
ocu05217  Basal cell carcinoma
ocu05224  Breast cancer
ocu05225  Hepatocellular carcinoma
ocu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100339765 (AXIN2)
   04390 Hippo signaling pathway
    100339765 (AXIN2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100339765 (AXIN2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100339765 (AXIN2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100339765 (AXIN2)
   05225 Hepatocellular carcinoma
    100339765 (AXIN2)
   05226 Gastric cancer
    100339765 (AXIN2)
   05217 Basal cell carcinoma
    100339765 (AXIN2)
   05213 Endometrial cancer
    100339765 (AXIN2)
   05224 Breast cancer
    100339765 (AXIN2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100339765 (AXIN2)
   05022 Pathways of neurodegeneration - multiple diseases
    100339765 (AXIN2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100339765 (AXIN2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100339765 (AXIN2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ocu03036]
    100339765 (AXIN2)
Chromosome and associated proteins [BR:ocu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    100339765 (AXIN2)
SSDB
Motif
Pfam: RGS DIX AXIN1_TNKS_BD SdrD_B
Other DBs
NCBI-GeneID: 100339765
NCBI-ProteinID: XP_017204336
LinkDB
Position
19
AA seq 737 aa
MSSAVLVTCLPDPSSSFREDAPRPPVPGEEGETPPCQLGVGKGHVTKPMPVSSNARRNED
GLGEPEGRASPDSPLTRWTKSLHCLLGDQDGAYLFRTFLEREKCVDTLDFWFACNGFRQM
NLKDTKTLRVAKAIYKRYIENNSIVSKQLRPATKTYIRDGIKKQQIDSIMFDQAQTEIQS
VMEGNAYQVFLTSDIYLEYVRSGGENPAYVSHGGLGSLKVLCGYLPTLNEEEEWTCADFK
CKLAPTVVGLSSKTLRATASVRSTETADSGYRSFKGNDPVNPYHVGSGYVFAPATSANDS
EISSDALTDDSMSMTDSSVDGIPPYRTGSKKQLQREMHRSVKANGQVSLPHFPSPGVGRX
QPRSRSPDHHHHHHQPYHPLLPPGGKLPPAAAAPTCPLLGGKGFVSKQTTKHVHHHYIHH
HAGPKTKEELEAEATQRVRCLCSEYYCYCKCKSHPKAPEPVPGEQFGGSRGSTLPKRSGK
GTEPGLALPAREGGAPGGAGALQLPGEEGDRSQDVWQWMLESERQSKPKPHSAQSTKKAS
PMESARGSPGERVSRHHLWGSSGHPRTAPRAHPFTQDPAVPPLTPPNTLAQLEEACRRLA
EVSKPPKQRCCVANQQRDRNHLAAGQAGATPFSNPSLAPEEHKRSKNLAGVHALQGSEVV
TYFFCGESKFRTGAAEAQSLTLGHFKEQLSKKGNYRYYFKKASDEFACGAVFEEVWDDET
VLPMYEGRILGKVERIE
NT seq 2214 nt   +upstreamnt  +downstreamnt
atgagcagtgctgtgctggtgacctgcctcccggatcctagcagcagcttccgggaggat
gcgccacggccccctgttcccggggaagaaggggagacccctccgtgccagctcggggtg
ggcaagggccacgtcaccaagcccatgcctgtgtcgtccaacgccaggcggaacgaagac
ggcctgggggagcccgaggggcgggcgtccccggactcccccctgaccaggtggaccaag
tccttgcactgcttgttgggggatcaggacggggcttacctcttccggaccttcctggag
agggagaaatgtgtggataccttggacttctggtttgcctgcaacgggttcaggcagatg
aacctgaaagataccaaaactttgcgagtagccaaagccatctacaagaggtacattgaa
aacaacagcatcgtgtccaagcagctgagacctgccaccaagacctacatccgggacggc
atcaagaagcagcagatcgactccatcatgttcgaccaggcgcagacagagatccagtcg
gtgatggaagggaacgcctaccaggtgttcctgacttccgacatatacctcgagtatgtg
aggagtgggggagagaacccggcgtacgtgagtcacgggggcctgggcagcctcaaggtc
ttgtgtggctacctccccaccttgaacgaagaggaggagtggacttgtgccgacttcaag
tgcaagctcgcccccacggtcgtcggcttgtccagcaagacgctgagggccacggccagt
gtgaggtccacagaaacagctgacagtgggtacaggtctttcaaggggaacgatcctgtg
aatccctaccacgtgggttccggctacgtcttcgcgccagccaccagcgccaatgacagc
gagatatccagcgacgccctgactgatgactccatgtccatgacggacagcagcgtagat
ggaatccctccttatcgcacggggagcaagaaacagctgcagagagagatgcatcgcagc
gtgaaggccaacggccaagtgtctctacctcatttcccgtcgcccggcgtgggccgcngc
cagccccgctcccgctcgcctgaccaccaccatcaccaccaccagccctaccaccccctc
ctcccgccggggggcaagctgccccccgcggccgccgccccgacctgcccactgctcggg
ggcaagggctttgtgagcaagcagaccacgaagcacgtccaccaccactacatccaccac
cacgccggccccaagaccaaggaggagctcgaggccgaggccacgcagagggtgcgctgt
ttgtgctccgagtattactgctactgcaagtgcaagagccaccccaaggctccggagccc
gtgccaggagagcagtttggtggaagcagaggcagtaccttgcccaaacgaagtgggaaa
ggcacggagcctggcctggccctgcccgctagggaaggaggggcccccggcggcgctggg
gccctgcagctgcctggagaagaaggagacaggtcgcaggatgtgtggcagtggatgctg
gagagtgagcgacagagcaagcccaagccccacagtgcccagagcacaaaaaaggcctcg
cccatggagtctgctcgcgggtccccgggcgaacgggtcagccggcaccatctgtggggg
agcagcgggcacccccgcaccgccccccgtgcccacccctttacccaagaccctgcagtg
ccccccctgaccccacccaacacgctggcacagctggaggaggcctgccgcaggctggct
gaggtgtcgaagccccccaagcagcggtgctgtgtggccaatcagcagagggacaggaac
cacttggccgctggtcaggcaggagccacgcccttctccaaccccagcctggcccccgaa
gaacacaaaagatccaaaaatctggcaggtgtacacgcgctccagggcagcgaggtcgtc
acttactttttctgcggagaaagtaaattccgtacaggagctgctgaagcgcagagcttg
accttgggccattttaaggagcagctcagcaaaaaggggaattataggtattacttcaaa
aaggcgagcgacgagtttgcctgcggagcagtgtttgaggaggtctgggatgacgagacc
gtgctcccgatgtacgaaggcaggattctgggcaaagtggagaggatagagtga

KEGG   Oryctolagus cuniculus (rabbit): 100348127
Entry
100348127         CDS       T03373                                 

Gene name
AXIN1
Definition
(RefSeq) axin 1
  KO
K02157  axin 1
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04310  Wnt signaling pathway
ocu04390  Hippo signaling pathway
ocu04550  Signaling pathways regulating pluripotency of stem cells
ocu04934  Cushing syndrome
ocu05010  Alzheimer disease
ocu05022  Pathways of neurodegeneration - multiple diseases
ocu05165  Human papillomavirus infection
ocu05200  Pathways in cancer
ocu05210  Colorectal cancer
ocu05213  Endometrial cancer
ocu05217  Basal cell carcinoma
ocu05224  Breast cancer
ocu05225  Hepatocellular carcinoma
ocu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100348127 (AXIN1)
   04390 Hippo signaling pathway
    100348127 (AXIN1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100348127 (AXIN1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100348127 (AXIN1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100348127 (AXIN1)
   05225 Hepatocellular carcinoma
    100348127 (AXIN1)
   05226 Gastric cancer
    100348127 (AXIN1)
   05217 Basal cell carcinoma
    100348127 (AXIN1)
   05213 Endometrial cancer
    100348127 (AXIN1)
   05224 Breast cancer
    100348127 (AXIN1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100348127 (AXIN1)
   05022 Pathways of neurodegeneration - multiple diseases
    100348127 (AXIN1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100348127 (AXIN1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100348127 (AXIN1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ocu01009]
    100348127 (AXIN1)
Protein phosphatases and associated proteins [BR:ocu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100348127 (AXIN1)
SSDB
Motif
Pfam: DIX RGS AXIN1_TNKS_BD Axin_b-cat_bind
Other DBs
NCBI-GeneID: 100348127
NCBI-ProteinID: XP_002724419
Ensembl: ENSOCUG00000023437
LinkDB
Position
Un
AA seq 831 aa
MSVQEQGFPLDLGASFTEDAPRPPVPGEEGELVSTDPRPASHSFCSGKAAGVKAETSTAT
PRRSDLDLGYEPEGSASPTPPYLKWAESLHSLLDDQDGISLFRTFLKQEGCADLLDFWFA
CSGFRKLEPCDANEEKRLKLARAIYRKYILDSTGIVSRHTKPATKSFIKDCIVRQQVDPA
MFDQAQTEIQATMEENTYPSFLKSDIYLEYTRTGSESPKVCSDQSSGSGTGKGLSGYLPT
LNEDEEWKCDQDTDEEEARDAAPPSRLTQKLLMETAAPRASSGRRYSEGREFRYGSWREP
VNPYYVNSGYALAPATSANDSEQQSLSSDADTLSLTDSSVDGIPPYRMRKQHRREMQESV
QVNGRVPLPHIPRTYRMPKEIRVEPQKFAEELIHRLEAVQRTREAEEKLEERLKRVRMEE
EGEDGDLPPGPPGASHKLPPAPAWHHFPARCVDLGCAGLRDAHEENPESILDEHVQRVMR
TPGCQSPGPGHRSPDSGHMAKVSATLGGVASGHGKHMPKSGAKLDVAGLHHHRHVHHHVH
HSTARPKEQVEAEAARRVQSSFAWGPEPHSHTAKTRSHSEGMGATPSAGDSLAYSGKAGM
PSRRSAKKAESGKNAAAEVPGASEDTERNQKIMQWLIEGEKEISRHRKTGHGSSGVRKQQ
AHESSRPLSIERPGAVHPWVSAQLRNSVQPSHLFIQDPTMPPNPAPNPLTQLEEARRRLE
EEEKRASKLPSKQRTKSQRKGAGGGSQACDSIVVAYYFCGEPIPYRTLVRGRAVTLGQFK
ELLTKKGSYRYYFKKVSDEFDCGVVFEEVREDEAVLPVFEEKVVGKVEKVD
NT seq 2496 nt   +upstreamnt  +downstreamnt
atgagcgtccaggagcagggtttccccctggacctcggagcaagtttcaccgaagatgcc
ccccggcccccggtgcctggggaggagggagaactggtgtccacagacccgaggcccgcc
agccacagcttctgctccggcaaagctgctggcgttaaagctgagacttcgacggctact
ccaaggcgctcggatctggacctggggtatgagcccgagggcagtgcgtctcccacgccg
ccatacttgaagtgggccgagtccctgcactccctgctggacgatcaagacgggatcagc
ctgttcaggactttcctcaagcaggagggctgtgctgaccttctggacttctggtttgcc
tgcagtggcttcaggaagctggagccctgcgatgcgaatgaggagaagaggctgaagctg
gctagagccatctaccgcaagtacatcctggacagcactggcatcgtgtccaggcacacc
aagccggccaccaagagcttcatcaaggactgcatcgtgaggcagcaggtcgaccccgcc
atgttcgaccaggcccagacggagatccaggccaccatggaggagaacacctacccctcc
ttcctcaagtctgacatttatttggagtacacgaggacaggctcggagagcccaaaggtc
tgtagtgaccagagctctgggtcaggcacagggaagggcctgtctggatacctgcccact
ctgaatgaagacgaggagtggaagtgtgaccaggacacggacgaggaggaagcgcgggac
gcggcgcctcccagcaggctcacccagaagctgctcatggagacggctgccccgagggcc
tcctcagggagacggtacagcgaaggcagagagttcagatacgggtcctggcgggagcct
gtcaacccctactacgtcaactctggctacgccctggccccagctaccagtgccaatgac
agcgagcagcagagcctgtccagcgacgccgacaccctgtccctcacagacagcagcgtg
gatgggatcccgccgtacaggatgcgcaagcagcaccgcagagagatgcaggagagcgtc
caggtcaacgggcgggtgcccctccctcacatcccccgcacctaccgaatgccaaaggag
atccgtgtggagccgcagaagttcgccgaggagctcatccaccggctggaggccgtgcag
cgcacgcgggaggccgaggagaagctggaggagcggctcaagcgtgtccgcatggaggaa
gaaggagaggatggtgaccttccccctgggcccccaggggcgagccacaagttgcctcct
gccccagcctggcaccacttcccggcccgctgtgtggacctgggctgcgccgggctgcgg
gacgcacacgaggagaaccccgagagcatcctggacgagcacgtgcagcgggtcatgcgg
acccctggctgccagtctcccggccctggccaccgctcccctgacagcgggcacatggcc
aaggtgtcggccacgctgggtggcgtggcctcggggcacgggaagcacatgcccaagtcg
ggggcgaagttggacgtggccggcctgcatcaccacaggcacgtccaccaccacgtccac
cacagtacagccaggcccaaggagcaggtggaggccgaggctgcccgcagggtccagagc
agcttcgcgtggggcccggaaccgcacagccacacagccaagacccgcagccactcagag
ggcatgggtgccacccccagcgccggcgacagcctggcctacagcgggaaagcaggcatg
ccctccagaagaagcgccaagaaggccgagtctgggaagaacgcggctgcggaggtgccg
ggcgcctcggaggacacggagcggaaccagaagatcatgcagtggctcatcgagggcgag
aaggagatcagcaggcaccggaagaccggccacgggtcctctggggtgcggaagcagcag
gcccacgagagctccaggcccttgtccattgaacgccctggggccgtgcacccctgggtc
agtgctcagctccggaactccgtccagccctctcatctcttcattcaagaccccaccatg
ccacccaaccccgcccccaaccccctgacccagctggaggaggcccgcaggcgtctggag
gaggaggagaagagagccagcaagctgccctccaaacagaggacgaagtcacagcggaag
ggggccggcgggggcagccaggcgtgcgacagcatcgtggtggcgtactacttctgcggg
gagcccatcccctaccggaccctggtcaggggccgtgctgtcaccctgggccagttcaag
gagctgctgaccaagaagggcagctacagatactacttcaagaaggtgagtgacgagttc
gactgtggagtggtgttcgaggaggtgcgcgaagacgaggccgtgctgcccgtcttcgag
gagaaggtcgtcggcaaggtggagaaggtcgactga

DBGET integrated database retrieval system