KEGG   Oryctolagus cuniculus (rabbit): 100340661
Entry
100340661         CDS       T03373                                 

Gene name
RHOA
Definition
(RefSeq) ras homolog family member A
  KO
K04513  Ras homolog gene family, member A
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04014  Ras signaling pathway
ocu04015  Rap1 signaling pathway
ocu04022  cGMP-PKG signaling pathway
ocu04024  cAMP signaling pathway
ocu04062  Chemokine signaling pathway
ocu04071  Sphingolipid signaling pathway
ocu04072  Phospholipase D signaling pathway
ocu04144  Endocytosis
ocu04150  mTOR signaling pathway
ocu04270  Vascular smooth muscle contraction
ocu04310  Wnt signaling pathway
ocu04350  TGF-beta signaling pathway
ocu04360  Axon guidance
ocu04510  Focal adhesion
ocu04520  Adherens junction
ocu04530  Tight junction
ocu04611  Platelet activation
ocu04621  NOD-like receptor signaling pathway
ocu04625  C-type lectin receptor signaling pathway
ocu04660  T cell receptor signaling pathway
ocu04670  Leukocyte transendothelial migration
ocu04722  Neurotrophin signaling pathway
ocu04810  Regulation of actin cytoskeleton
ocu04921  Oxytocin signaling pathway
ocu04928  Parathyroid hormone synthesis, secretion and action
ocu04972  Pancreatic secretion
ocu05100  Bacterial invasion of epithelial cells
ocu05132  Salmonella infection
ocu05133  Pertussis
ocu05135  Yersinia infection
ocu05152  Tuberculosis
ocu05163  Human cytomegalovirus infection
ocu05200  Pathways in cancer
ocu05203  Viral carcinogenesis
ocu05205  Proteoglycans in cancer
ocu05206  MicroRNAs in cancer
ocu05210  Colorectal cancer
ocu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100340661 (RHOA)
   04015 Rap1 signaling pathway
    100340661 (RHOA)
   04310 Wnt signaling pathway
    100340661 (RHOA)
   04350 TGF-beta signaling pathway
    100340661 (RHOA)
   04072 Phospholipase D signaling pathway
    100340661 (RHOA)
   04071 Sphingolipid signaling pathway
    100340661 (RHOA)
   04024 cAMP signaling pathway
    100340661 (RHOA)
   04022 cGMP-PKG signaling pathway
    100340661 (RHOA)
   04150 mTOR signaling pathway
    100340661 (RHOA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100340661 (RHOA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100340661 (RHOA)
   04520 Adherens junction
    100340661 (RHOA)
   04530 Tight junction
    100340661 (RHOA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100340661 (RHOA)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100340661 (RHOA)
   04621 NOD-like receptor signaling pathway
    100340661 (RHOA)
   04625 C-type lectin receptor signaling pathway
    100340661 (RHOA)
   04660 T cell receptor signaling pathway
    100340661 (RHOA)
   04670 Leukocyte transendothelial migration
    100340661 (RHOA)
   04062 Chemokine signaling pathway
    100340661 (RHOA)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100340661 (RHOA)
   04928 Parathyroid hormone synthesis, secretion and action
    100340661 (RHOA)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100340661 (RHOA)
  09154 Digestive system
   04972 Pancreatic secretion
    100340661 (RHOA)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100340661 (RHOA)
  09158 Development and regeneration
   04360 Axon guidance
    100340661 (RHOA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100340661 (RHOA)
   05206 MicroRNAs in cancer
    100340661 (RHOA)
   05205 Proteoglycans in cancer
    100340661 (RHOA)
   05203 Viral carcinogenesis
    100340661 (RHOA)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100340661 (RHOA)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100340661 (RHOA)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100340661 (RHOA)
   05135 Yersinia infection
    100340661 (RHOA)
   05133 Pertussis
    100340661 (RHOA)
   05152 Tuberculosis
    100340661 (RHOA)
   05100 Bacterial invasion of epithelial cells
    100340661 (RHOA)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    100340661 (RHOA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100340661 (RHOA)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ocu04147]
    100340661 (RHOA)
   04031 GTP-binding proteins [BR:ocu04031]
    100340661 (RHOA)
Membrane trafficking [BR:ocu04131]
 Endocytosis
  Lipid raft mediated endocytosis
   RhoA-dependent endocytosis
    100340661 (RHOA)
Exosome [BR:ocu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100340661 (RHOA)
  Exosomal proteins of other body fluids (saliva and urine)
   100340661 (RHOA)
  Exosomal proteins of colorectal cancer cells
   100340661 (RHOA)
  Exosomal proteins of bladder cancer cells
   100340661 (RHOA)
GTP-binding proteins [BR:ocu04031]
 Small (monomeric) G-proteins
  Rho Family
   RhoA/B/C [OT]
    100340661 (RHOA)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU SRPRB Gtr1_RagA
Other DBs
NCBI-GeneID: 100340661
NCBI-ProteinID: XP_002713474
Ensembl: ENSOCUG00000013323
UniProt: G1T567
LinkDB
Position
9
AA seq 193 aa
MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT
AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD
LRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ
ARRGKKKSGCLVL
NT seq 582 nt   +upstreamnt  +downstreamnt
atggctgccatccggaagaaactggtgattgtcggtgatggtgcttgtggcaagacgtgc
ttgctgatagtcttcagcaaggaccagttcccagaggtgtatgtccccacagtgtttgag
aactatgtggcagatatcgaagtggatgggaaacaggtagagctggctttgtgggacaca
gctggccaggaagattatgatcgcctgaggcccctctcctacccagacactgatgttatc
ctgatgtgtttctccattgacagccctgatagtttagaaaatatcccagaaaaatggacc
ccagaagtgaagcatttctgtcccaacgtgcccatcatcctggttgggaacaagaaggat
cttcggaatgatgaacacacaaggcgggagctagccaagatgaagcaggagccagtaaaa
cctgaagagggcagagatatggcaaacaggattggcgcctttgggtacatggagtgttca
gcaaagaccaaagatggagtgagggaggtttttgaaatggccacgagagcggctctgcaa
gccagacgtgggaagaaaaaatccgggtgccttgtcttgtga

KEGG   Oryctolagus cuniculus (rabbit): 100346856
Entry
100346856         CDS       T03373                                 

Definition
(RefSeq) transforming protein RhoA-like
  KO
K04513  Ras homolog gene family, member A
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04014  Ras signaling pathway
ocu04015  Rap1 signaling pathway
ocu04022  cGMP-PKG signaling pathway
ocu04024  cAMP signaling pathway
ocu04062  Chemokine signaling pathway
ocu04071  Sphingolipid signaling pathway
ocu04072  Phospholipase D signaling pathway
ocu04144  Endocytosis
ocu04150  mTOR signaling pathway
ocu04270  Vascular smooth muscle contraction
ocu04310  Wnt signaling pathway
ocu04350  TGF-beta signaling pathway
ocu04360  Axon guidance
ocu04510  Focal adhesion
ocu04520  Adherens junction
ocu04530  Tight junction
ocu04611  Platelet activation
ocu04621  NOD-like receptor signaling pathway
ocu04625  C-type lectin receptor signaling pathway
ocu04660  T cell receptor signaling pathway
ocu04670  Leukocyte transendothelial migration
ocu04722  Neurotrophin signaling pathway
ocu04810  Regulation of actin cytoskeleton
ocu04921  Oxytocin signaling pathway
ocu04928  Parathyroid hormone synthesis, secretion and action
ocu04972  Pancreatic secretion
ocu05100  Bacterial invasion of epithelial cells
ocu05132  Salmonella infection
ocu05133  Pertussis
ocu05135  Yersinia infection
ocu05152  Tuberculosis
ocu05163  Human cytomegalovirus infection
ocu05200  Pathways in cancer
ocu05203  Viral carcinogenesis
ocu05205  Proteoglycans in cancer
ocu05206  MicroRNAs in cancer
ocu05210  Colorectal cancer
ocu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100346856
   04015 Rap1 signaling pathway
    100346856
   04310 Wnt signaling pathway
    100346856
   04350 TGF-beta signaling pathway
    100346856
   04072 Phospholipase D signaling pathway
    100346856
   04071 Sphingolipid signaling pathway
    100346856
   04024 cAMP signaling pathway
    100346856
   04022 cGMP-PKG signaling pathway
    100346856
   04150 mTOR signaling pathway
    100346856
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100346856
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100346856
   04520 Adherens junction
    100346856
   04530 Tight junction
    100346856
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100346856
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100346856
   04621 NOD-like receptor signaling pathway
    100346856
   04625 C-type lectin receptor signaling pathway
    100346856
   04660 T cell receptor signaling pathway
    100346856
   04670 Leukocyte transendothelial migration
    100346856
   04062 Chemokine signaling pathway
    100346856
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100346856
   04928 Parathyroid hormone synthesis, secretion and action
    100346856
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100346856
  09154 Digestive system
   04972 Pancreatic secretion
    100346856
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100346856
  09158 Development and regeneration
   04360 Axon guidance
    100346856
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100346856
   05206 MicroRNAs in cancer
    100346856
   05205 Proteoglycans in cancer
    100346856
   05203 Viral carcinogenesis
    100346856
  09162 Cancer: specific types
   05210 Colorectal cancer
    100346856
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100346856
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100346856
   05135 Yersinia infection
    100346856
   05133 Pertussis
    100346856
   05152 Tuberculosis
    100346856
   05100 Bacterial invasion of epithelial cells
    100346856
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    100346856
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100346856
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ocu04147]
    100346856
   04031 GTP-binding proteins [BR:ocu04031]
    100346856
Membrane trafficking [BR:ocu04131]
 Endocytosis
  Lipid raft mediated endocytosis
   RhoA-dependent endocytosis
    100346856
Exosome [BR:ocu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100346856
  Exosomal proteins of other body fluids (saliva and urine)
   100346856
  Exosomal proteins of colorectal cancer cells
   100346856
  Exosomal proteins of bladder cancer cells
   100346856
GTP-binding proteins [BR:ocu04031]
 Small (monomeric) G-proteins
  Rho Family
   RhoA/B/C [OT]
    100346856
SSDB
Motif
Pfam: Ras Roc Arf
Other DBs
NCBI-GeneID: 100346856
NCBI-ProteinID: XP_008251117
UniProt: G1TGR0
LinkDB
Position
Un
AA seq 316 aa
MLGPHTASGHYCRCTHRTAPSPRCHHGGYKYEVHTQLPVIPAVVHTAPCRLHTAIPRRPH
TALTWRGEGKARRVSRSRSCRAPERLAHVSSLVSLRNAPDWRPGRACGAAPPSAMAALRK
KLVVVGAGACGKTSPLVVFSRDHFPEEYVPTVFENYVADVEVDGRRVELALWDTAGQEEH
DRLRPLSYPDTDVVLLCFAISSPDSLENVPAKWAPEVRHFCPGVPLVLVGNKKDLRNDAG
TRRALAAWKQEPVRPEAGRDVASRIGAFGYLECSAKTKEGVREVFEMATRAALHARRGKK
SGLPKTANRKSPCYSV
NT seq 951 nt   +upstreamnt  +downstreamnt
atgttaggtccacacacagcttccggtcactactgccgttgtacacaccgcaccgcacca
tctccacgctgccatcatggtggttataaatacgaggtccacacacagcttccggtcatt
cctgccgttgtacacaccgcaccgtgccgtctccacacggccattccgcgccgtcctcac
actgccctcacttggcggggagaagggaaagcgcgccgcgtctcccgctcccggagctgc
agggctcccgagcggctcgcgcacgtcagttccctcgtcagcctccgcaacgccccggac
tggcgcccgggcagggcctgcggcgcggcgcctccctccgccatggctgccctccggaag
aagctggtggtggtgggagccggcgcctgcggcaagacgagcccgctggtggtgttcagc
cgcgaccacttcccggaggagtacgtgcccacggtgttcgagaactacgtggccgacgtg
gaggtggacggccggcgggtggagctggcgctgtgggacacggccggccaggaggagcac
gaccgcctgcggccgctgtcctacccggacaccgacgtcgtgctcctgtgcttcgccatc
agcagcccggacagcctggagaacgtgccggccaagtgggccccggaggtccggcacttc
tgccccggcgtgcccctcgtcctggtggggaacaagaaggacctgcggaacgacgcgggc
accaggcgggcgctggcggcctggaagcaggagcccgtgcggcctgaggcaggcagggac
gtggccagcaggattggcgccttcggctacctggagtgttcggcgaagaccaaagagggc
gtgagggaggtgtttgagatggccacgagggctgctctgcacgccagacgcggcaagaag
agtggtttaccaaagactgcaaaccggaagtcaccttgctacagcgtttag

KEGG   Oryctolagus cuniculus (rabbit): 100348967
Entry
100348967         CDS       T03373                                 

Definition
(RefSeq) transforming protein RhoA-like
  KO
K04513  Ras homolog gene family, member A
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04014  Ras signaling pathway
ocu04015  Rap1 signaling pathway
ocu04022  cGMP-PKG signaling pathway
ocu04024  cAMP signaling pathway
ocu04062  Chemokine signaling pathway
ocu04071  Sphingolipid signaling pathway
ocu04072  Phospholipase D signaling pathway
ocu04144  Endocytosis
ocu04150  mTOR signaling pathway
ocu04270  Vascular smooth muscle contraction
ocu04310  Wnt signaling pathway
ocu04350  TGF-beta signaling pathway
ocu04360  Axon guidance
ocu04510  Focal adhesion
ocu04520  Adherens junction
ocu04530  Tight junction
ocu04611  Platelet activation
ocu04621  NOD-like receptor signaling pathway
ocu04625  C-type lectin receptor signaling pathway
ocu04660  T cell receptor signaling pathway
ocu04670  Leukocyte transendothelial migration
ocu04722  Neurotrophin signaling pathway
ocu04810  Regulation of actin cytoskeleton
ocu04921  Oxytocin signaling pathway
ocu04928  Parathyroid hormone synthesis, secretion and action
ocu04972  Pancreatic secretion
ocu05100  Bacterial invasion of epithelial cells
ocu05132  Salmonella infection
ocu05133  Pertussis
ocu05135  Yersinia infection
ocu05152  Tuberculosis
ocu05163  Human cytomegalovirus infection
ocu05200  Pathways in cancer
ocu05203  Viral carcinogenesis
ocu05205  Proteoglycans in cancer
ocu05206  MicroRNAs in cancer
ocu05210  Colorectal cancer
ocu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100348967
   04015 Rap1 signaling pathway
    100348967
   04310 Wnt signaling pathway
    100348967
   04350 TGF-beta signaling pathway
    100348967
   04072 Phospholipase D signaling pathway
    100348967
   04071 Sphingolipid signaling pathway
    100348967
   04024 cAMP signaling pathway
    100348967
   04022 cGMP-PKG signaling pathway
    100348967
   04150 mTOR signaling pathway
    100348967
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100348967
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100348967
   04520 Adherens junction
    100348967
   04530 Tight junction
    100348967
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100348967
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100348967
   04621 NOD-like receptor signaling pathway
    100348967
   04625 C-type lectin receptor signaling pathway
    100348967
   04660 T cell receptor signaling pathway
    100348967
   04670 Leukocyte transendothelial migration
    100348967
   04062 Chemokine signaling pathway
    100348967
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100348967
   04928 Parathyroid hormone synthesis, secretion and action
    100348967
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100348967
  09154 Digestive system
   04972 Pancreatic secretion
    100348967
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100348967
  09158 Development and regeneration
   04360 Axon guidance
    100348967
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100348967
   05206 MicroRNAs in cancer
    100348967
   05205 Proteoglycans in cancer
    100348967
   05203 Viral carcinogenesis
    100348967
  09162 Cancer: specific types
   05210 Colorectal cancer
    100348967
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100348967
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100348967
   05135 Yersinia infection
    100348967
   05133 Pertussis
    100348967
   05152 Tuberculosis
    100348967
   05100 Bacterial invasion of epithelial cells
    100348967
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    100348967
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100348967
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ocu04147]
    100348967
   04031 GTP-binding proteins [BR:ocu04031]
    100348967
Membrane trafficking [BR:ocu04131]
 Endocytosis
  Lipid raft mediated endocytosis
   RhoA-dependent endocytosis
    100348967
Exosome [BR:ocu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100348967
  Exosomal proteins of other body fluids (saliva and urine)
   100348967
  Exosomal proteins of colorectal cancer cells
   100348967
  Exosomal proteins of bladder cancer cells
   100348967
GTP-binding proteins [BR:ocu04031]
 Small (monomeric) G-proteins
  Rho Family
   RhoA/B/C [OT]
    100348967
SSDB
Motif
Pfam: Ras Roc Arf SRPRB
Other DBs
NCBI-GeneID: 100348967
NCBI-ProteinID: XP_008251595
UniProt: G1TTV0
LinkDB
Position
Un
AA seq 316 aa
MLGPHTASGHYCRCTHRTALSPCRHHGCYKYEVHTQLPVIPAVVHTAPCRLHTAIPRRPH
TALTWRGEGKARRVSRSRSCRAPEQLAHVSSLVSLRDAPDWRPGWACGAAPPSAMAALRK
KLVVVGAGACGKTSLLVVFSRDHFPEEYVPTVFENYVADVEVDGRRVELALWDTAGQEEH
DRLRPLSYPDTDVVLLCFAISSPDSLENVPAKWAPEVRHFCPSVPLVLVGNKKDLRNDAG
TRRALAAWKQEPVRPEAGRDVASRIGAFGYLECLAKTKEGVREVFEMATRAALHARRGKK
SGLPKTANRKSPCYSV
NT seq 951 nt   +upstreamnt  +downstreamnt
atgttaggtccacacacagcttccggtcactactgccgttgtacacaccgcaccgcatta
tctccatgccgccatcatggttgttataaatacgaggtccacacacagcttccggtcatt
cctgccgttgtacacaccgcaccgtgccgtctccacacggccattccgcgccgccctcac
actgccctcacttggcggggagaagggaaagcgcgccgcgtctcccgctcccggagctgc
agggctcccgagcagctcgcgcacgtcagttccctcgtcagcctccgcgacgccccggac
tggcgcccgggctgggcctgcggcgcggcgcctccctccgccatggctgccctccggaag
aagctggtggtggtgggagccggcgcctgcggcaagacgagcctgctggtggtgttcagc
cgcgaccacttcccggaggagtacgtgcccacggtgttcgagaactacgtggccgacgtg
gaggtggacggccggcgggtggagctggcgctgtgggacacggccggccaggaggagcac
gaccgcctgcggccgctgtcctacccggacaccgacgtcgtgctcctgtgcttcgccatc
agcagcccggacagcctggagaacgtgccggccaagtgggccccggaggtccggcacttc
tgccccagcgtgcccctcgtcctggtggggaacaagaaggacctgcggaacgacgcgggc
accaggcgggcgctggcggcctggaagcaggagcccgtgcggcctgaggcaggcagggac
gtggccagcaggattggtgccttcggctacctggagtgtttggcgaagaccaaagagggc
gtgagggaggtgtttgagatggccacgagggctgctctgcacgccagacgcggcaagaag
agtggtttaccaaagactgcaaaccggaagtcaccttgctacagcgtttag

KEGG   Oryctolagus cuniculus (rabbit): 100356250
Entry
100356250         CDS       T03373                                 

Definition
(RefSeq) transforming protein RhoA-like
  KO
K04513  Ras homolog gene family, member A
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04014  Ras signaling pathway
ocu04015  Rap1 signaling pathway
ocu04022  cGMP-PKG signaling pathway
ocu04024  cAMP signaling pathway
ocu04062  Chemokine signaling pathway
ocu04071  Sphingolipid signaling pathway
ocu04072  Phospholipase D signaling pathway
ocu04144  Endocytosis
ocu04150  mTOR signaling pathway
ocu04270  Vascular smooth muscle contraction
ocu04310  Wnt signaling pathway
ocu04350  TGF-beta signaling pathway
ocu04360  Axon guidance
ocu04510  Focal adhesion
ocu04520  Adherens junction
ocu04530  Tight junction
ocu04611  Platelet activation
ocu04621  NOD-like receptor signaling pathway
ocu04625  C-type lectin receptor signaling pathway
ocu04660  T cell receptor signaling pathway
ocu04670  Leukocyte transendothelial migration
ocu04722  Neurotrophin signaling pathway
ocu04810  Regulation of actin cytoskeleton
ocu04921  Oxytocin signaling pathway
ocu04928  Parathyroid hormone synthesis, secretion and action
ocu04972  Pancreatic secretion
ocu05100  Bacterial invasion of epithelial cells
ocu05132  Salmonella infection
ocu05133  Pertussis
ocu05135  Yersinia infection
ocu05152  Tuberculosis
ocu05163  Human cytomegalovirus infection
ocu05200  Pathways in cancer
ocu05203  Viral carcinogenesis
ocu05205  Proteoglycans in cancer
ocu05206  MicroRNAs in cancer
ocu05210  Colorectal cancer
ocu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100356250
   04015 Rap1 signaling pathway
    100356250
   04310 Wnt signaling pathway
    100356250
   04350 TGF-beta signaling pathway
    100356250
   04072 Phospholipase D signaling pathway
    100356250
   04071 Sphingolipid signaling pathway
    100356250
   04024 cAMP signaling pathway
    100356250
   04022 cGMP-PKG signaling pathway
    100356250
   04150 mTOR signaling pathway
    100356250
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100356250
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100356250
   04520 Adherens junction
    100356250
   04530 Tight junction
    100356250
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100356250
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100356250
   04621 NOD-like receptor signaling pathway
    100356250
   04625 C-type lectin receptor signaling pathway
    100356250
   04660 T cell receptor signaling pathway
    100356250
   04670 Leukocyte transendothelial migration
    100356250
   04062 Chemokine signaling pathway
    100356250
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100356250
   04928 Parathyroid hormone synthesis, secretion and action
    100356250
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100356250
  09154 Digestive system
   04972 Pancreatic secretion
    100356250
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100356250
  09158 Development and regeneration
   04360 Axon guidance
    100356250
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100356250
   05206 MicroRNAs in cancer
    100356250
   05205 Proteoglycans in cancer
    100356250
   05203 Viral carcinogenesis
    100356250
  09162 Cancer: specific types
   05210 Colorectal cancer
    100356250
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100356250
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100356250
   05135 Yersinia infection
    100356250
   05133 Pertussis
    100356250
   05152 Tuberculosis
    100356250
   05100 Bacterial invasion of epithelial cells
    100356250
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    100356250
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100356250
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ocu04147]
    100356250
   04031 GTP-binding proteins [BR:ocu04031]
    100356250
Membrane trafficking [BR:ocu04131]
 Endocytosis
  Lipid raft mediated endocytosis
   RhoA-dependent endocytosis
    100356250
Exosome [BR:ocu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100356250
  Exosomal proteins of other body fluids (saliva and urine)
   100356250
  Exosomal proteins of colorectal cancer cells
   100356250
  Exosomal proteins of bladder cancer cells
   100356250
GTP-binding proteins [BR:ocu04031]
 Small (monomeric) G-proteins
  Rho Family
   RhoA/B/C [OT]
    100356250
SSDB
Motif
Pfam: Ras Roc Arf SRPRB
Other DBs
NCBI-GeneID: 100356250
NCBI-ProteinID: XP_008249359
UniProt: G1TFK6
LinkDB
Position
Un
AA seq 292 aa
MVVINTRSTHSFRSFLPLYTPHRAVSTRPFRAVLTLPSLGGEKGKRAASPAPGAAGLPSG
SRTSVPPSASATPRTGARAGPAAGAAPPSAMAALRKKLVVVGAGACGKTSLLVVFSRDHF
PEEYVPTVFENYVADVEVDGRRVELALWDTAGQEEHDRLRPLSYPDTDVVLLCFAISSPD
SLENVPAKWAPEVRHFCPGVPLVLVGNKKDLRNDAGTRRVLAAWKQEPVRPEAGRDVASR
IGAFGYLECSAKTKEGVREVFEMATRAALHARRGKKSGLPKTANRKSPCYSV
NT seq 879 nt   +upstreamnt  +downstreamnt
atggtggttataaatacgaggtccacacacagcttccggtcattcctgccgttgtacaca
ccgcaccgtgccgtctccacacggccattccgcgccgtcctcacactgccctcacttggc
ggggagaagggaaagcgcgccgcgtctcccgctcccggagctgcagggctcccgagcggc
tcgcgcacgtccgttcccccgtcagcctccgcgacgccccggactggcgcccgggctggg
cctgcggcgggcgcggcgcctccctccgccatggctgccctccggaagaagctggtggtg
gtgggagccggcgcctgcggcaagacgagcctgctggtggtgttcagccgcgaccacttc
ccggaggagtacgtgcccacggtgttcgagaactacgtggccgacgtggaggtggacggc
cggcgggtggagctggcgctgtgggacacggccggccaggaggagcacgaccgcctgcgg
ccgctgtcctacccggacaccgacgtcgtgctcctgtgcttcgccatcagcagcccggac
agcctggagaacgtgccggccaagtgggccccggaggtccggcacttctgccccggcgtg
cccctcgtcctggtggggaacaagaaggacctgcggaacgacgcgggcaccaggcgggtg
ctggcggcctggaagcaggagcccgtgcggcctgaggcaggcagggacgtggccagcagg
attggcgccttcggctacctggagtgttcggcgaagaccaaagagggcgtgagggaggtg
tttgagatggccacgagggctgctctgcacgccagacgcggcaagaagagtggtttacca
aagactgcaaaccggaagtcaccttgctacagcgtttag

DBGET integrated database retrieval system