Oryctolagus cuniculus (rabbit): 100340661 Help Entry 100340661         CDS       T03373                                  Gene name RHOA Definition (RefSeq) ras homolog family member A   KO K04513   Ras homolog gene family, member A Organism ocu  Oryctolagus cuniculus (rabbit) Pathway ocu04014   Ras signaling pathway ocu04015   Rap1 signaling pathway ocu04022   cGMP-PKG signaling pathway ocu04024   cAMP signaling pathway ocu04062   Chemokine signaling pathway ocu04071   Sphingolipid signaling pathway ocu04072   Phospholipase D signaling pathway ocu04144   Endocytosis ocu04150   mTOR signaling pathway ocu04270   Vascular smooth muscle contraction ocu04310   Wnt signaling pathway ocu04350   TGF-beta signaling pathway ocu04360   Axon guidance ocu04510   Focal adhesion ocu04520   Adherens junction ocu04530   Tight junction ocu04611   Platelet activation ocu04621   NOD-like receptor signaling pathway ocu04625   C-type lectin receptor signaling pathway ocu04660   T cell receptor signaling pathway ocu04670   Leukocyte transendothelial migration ocu04722   Neurotrophin signaling pathway ocu04810   Regulation of actin cytoskeleton ocu04921   Oxytocin signaling pathway ocu04928   Parathyroid hormone synthesis, secretion and action ocu04972   Pancreatic secretion ocu05100   Bacterial invasion of epithelial cells ocu05132   Salmonella infection ocu05133   Pertussis ocu05135   Yersinia infection ocu05152   Tuberculosis ocu05163   Human cytomegalovirus infection ocu05200   Pathways in cancer ocu05203   Viral carcinogenesis ocu05205   Proteoglycans in cancer ocu05206   MicroRNAs in cancer ocu05210   Colorectal cancer ocu05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:ocu00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     100340661 (RHOA)    04015 Rap1 signaling pathway     100340661 (RHOA)    04310 Wnt signaling pathway     100340661 (RHOA)    04350 TGF-beta signaling pathway     100340661 (RHOA)    04072 Phospholipase D signaling pathway     100340661 (RHOA)    04071 Sphingolipid signaling pathway     100340661 (RHOA)    04024 cAMP signaling pathway     100340661 (RHOA)    04022 cGMP-PKG signaling pathway     100340661 (RHOA)    04150 mTOR signaling pathway     100340661 (RHOA)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     100340661 (RHOA)   09144 Cellular community - eukaryotes    04510 Focal adhesion     100340661 (RHOA)    04520 Adherens junction     100340661 (RHOA)    04530 Tight junction     100340661 (RHOA)   09142 Cell motility    04810 Regulation of actin cytoskeleton     100340661 (RHOA)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     100340661 (RHOA)    04621 NOD-like receptor signaling pathway     100340661 (RHOA)    04625 C-type lectin receptor signaling pathway     100340661 (RHOA)    04660 T cell receptor signaling pathway     100340661 (RHOA)    04670 Leukocyte transendothelial migration     100340661 (RHOA)    04062 Chemokine signaling pathway     100340661 (RHOA)   09152 Endocrine system    04921 Oxytocin signaling pathway     100340661 (RHOA)    04928 Parathyroid hormone synthesis, secretion and action     100340661 (RHOA)   09153 Circulatory system    04270 Vascular smooth muscle contraction     100340661 (RHOA)   09154 Digestive system    04972 Pancreatic secretion     100340661 (RHOA)   09156 Nervous system    04722 Neurotrophin signaling pathway     100340661 (RHOA)   09158 Development and regeneration    04360 Axon guidance     100340661 (RHOA)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100340661 (RHOA)    05206 MicroRNAs in cancer     100340661 (RHOA)    05205 Proteoglycans in cancer     100340661 (RHOA)    05203 Viral carcinogenesis     100340661 (RHOA)   09162 Cancer: specific types    05210 Colorectal cancer     100340661 (RHOA)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     100340661 (RHOA)   09171 Infectious disease: bacterial    05132 Salmonella infection     100340661 (RHOA)    05135 Yersinia infection     100340661 (RHOA)    05133 Pertussis     100340661 (RHOA)    05152 Tuberculosis     100340661 (RHOA)    05100 Bacterial invasion of epithelial cells     100340661 (RHOA)   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     100340661 (RHOA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ocu04131]     100340661 (RHOA)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ocu04147]     100340661 (RHOA)    04031 GTP-binding proteins [BR:ocu04031]     100340661 (RHOA) Membrane trafficking [BR:ocu04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     100340661 (RHOA) Exosome [BR:ocu04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    100340661 (RHOA)   Exosomal proteins of other body fluids (saliva and urine)    100340661 (RHOA)   Exosomal proteins of colorectal cancer cells    100340661 (RHOA)   Exosomal proteins of bladder cancer cells    100340661 (RHOA) GTP-binding proteins [BR:ocu04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     100340661 (RHOA) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU SRPRB Gtr1_RagA Motif Other DBs NCBI-GeneID:  100340661 NCBI-ProteinID:  XP_002713474 Ensembl:  ENSOCUG00000013323 UniProt:  G1T567 LinkDB All DBs Position 9 AA seq 193 aa AA seqDB search MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD LRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ ARRGKKKSGCLVL NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atggctgccatccggaagaaactggtgattgtcggtgatggtgcttgtggcaagacgtgc ttgctgatagtcttcagcaaggaccagttcccagaggtgtatgtccccacagtgtttgag aactatgtggcagatatcgaagtggatgggaaacaggtagagctggctttgtgggacaca gctggccaggaagattatgatcgcctgaggcccctctcctacccagacactgatgttatc ctgatgtgtttctccattgacagccctgatagtttagaaaatatcccagaaaaatggacc ccagaagtgaagcatttctgtcccaacgtgcccatcatcctggttgggaacaagaaggat cttcggaatgatgaacacacaaggcgggagctagccaagatgaagcaggagccagtaaaa cctgaagagggcagagatatggcaaacaggattggcgcctttgggtacatggagtgttca gcaaagaccaaagatggagtgagggaggtttttgaaatggccacgagagcggctctgcaa gccagacgtgggaagaaaaaatccgggtgccttgtcttgtga

Oryctolagus cuniculus (rabbit): 100346856 Help Entry 100346856         CDS       T03373                                  Definition (RefSeq) transforming protein RhoA-like   KO K04513   Ras homolog gene family, member A Organism ocu  Oryctolagus cuniculus (rabbit) Pathway ocu04014   Ras signaling pathway ocu04015   Rap1 signaling pathway ocu04022   cGMP-PKG signaling pathway ocu04024   cAMP signaling pathway ocu04062   Chemokine signaling pathway ocu04071   Sphingolipid signaling pathway ocu04072   Phospholipase D signaling pathway ocu04144   Endocytosis ocu04150   mTOR signaling pathway ocu04270   Vascular smooth muscle contraction ocu04310   Wnt signaling pathway ocu04350   TGF-beta signaling pathway ocu04360   Axon guidance ocu04510   Focal adhesion ocu04520   Adherens junction ocu04530   Tight junction ocu04611   Platelet activation ocu04621   NOD-like receptor signaling pathway ocu04625   C-type lectin receptor signaling pathway ocu04660   T cell receptor signaling pathway ocu04670   Leukocyte transendothelial migration ocu04722   Neurotrophin signaling pathway ocu04810   Regulation of actin cytoskeleton ocu04921   Oxytocin signaling pathway ocu04928   Parathyroid hormone synthesis, secretion and action ocu04972   Pancreatic secretion ocu05100   Bacterial invasion of epithelial cells ocu05132   Salmonella infection ocu05133   Pertussis ocu05135   Yersinia infection ocu05152   Tuberculosis ocu05163   Human cytomegalovirus infection ocu05200   Pathways in cancer ocu05203   Viral carcinogenesis ocu05205   Proteoglycans in cancer ocu05206   MicroRNAs in cancer ocu05210   Colorectal cancer ocu05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:ocu00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     100346856    04015 Rap1 signaling pathway     100346856    04310 Wnt signaling pathway     100346856    04350 TGF-beta signaling pathway     100346856    04072 Phospholipase D signaling pathway     100346856    04071 Sphingolipid signaling pathway     100346856    04024 cAMP signaling pathway     100346856    04022 cGMP-PKG signaling pathway     100346856    04150 mTOR signaling pathway     100346856  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     100346856   09144 Cellular community - eukaryotes    04510 Focal adhesion     100346856    04520 Adherens junction     100346856    04530 Tight junction     100346856   09142 Cell motility    04810 Regulation of actin cytoskeleton     100346856  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     100346856    04621 NOD-like receptor signaling pathway     100346856    04625 C-type lectin receptor signaling pathway     100346856    04660 T cell receptor signaling pathway     100346856    04670 Leukocyte transendothelial migration     100346856    04062 Chemokine signaling pathway     100346856   09152 Endocrine system    04921 Oxytocin signaling pathway     100346856    04928 Parathyroid hormone synthesis, secretion and action     100346856   09153 Circulatory system    04270 Vascular smooth muscle contraction     100346856   09154 Digestive system    04972 Pancreatic secretion     100346856   09156 Nervous system    04722 Neurotrophin signaling pathway     100346856   09158 Development and regeneration    04360 Axon guidance     100346856  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100346856    05206 MicroRNAs in cancer     100346856    05205 Proteoglycans in cancer     100346856    05203 Viral carcinogenesis     100346856   09162 Cancer: specific types    05210 Colorectal cancer     100346856   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     100346856   09171 Infectious disease: bacterial    05132 Salmonella infection     100346856    05135 Yersinia infection     100346856    05133 Pertussis     100346856    05152 Tuberculosis     100346856    05100 Bacterial invasion of epithelial cells     100346856   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     100346856  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ocu04131]     100346856   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ocu04147]     100346856    04031 GTP-binding proteins [BR:ocu04031]     100346856 Membrane trafficking [BR:ocu04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     100346856 Exosome [BR:ocu04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    100346856   Exosomal proteins of other body fluids (saliva and urine)    100346856   Exosomal proteins of colorectal cancer cells    100346856   Exosomal proteins of bladder cancer cells    100346856 GTP-binding proteins [BR:ocu04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     100346856 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf Motif Other DBs NCBI-GeneID:  100346856 NCBI-ProteinID:  XP_008251117 UniProt:  G1TGR0 LinkDB All DBs Position Un AA seq 316 aa AA seqDB search MLGPHTASGHYCRCTHRTAPSPRCHHGGYKYEVHTQLPVIPAVVHTAPCRLHTAIPRRPH TALTWRGEGKARRVSRSRSCRAPERLAHVSSLVSLRNAPDWRPGRACGAAPPSAMAALRK KLVVVGAGACGKTSPLVVFSRDHFPEEYVPTVFENYVADVEVDGRRVELALWDTAGQEEH DRLRPLSYPDTDVVLLCFAISSPDSLENVPAKWAPEVRHFCPGVPLVLVGNKKDLRNDAG TRRALAAWKQEPVRPEAGRDVASRIGAFGYLECSAKTKEGVREVFEMATRAALHARRGKK SGLPKTANRKSPCYSV NT seq 951 nt NT seq  +upstreamnt  +downstreamnt atgttaggtccacacacagcttccggtcactactgccgttgtacacaccgcaccgcacca tctccacgctgccatcatggtggttataaatacgaggtccacacacagcttccggtcatt cctgccgttgtacacaccgcaccgtgccgtctccacacggccattccgcgccgtcctcac actgccctcacttggcggggagaagggaaagcgcgccgcgtctcccgctcccggagctgc agggctcccgagcggctcgcgcacgtcagttccctcgtcagcctccgcaacgccccggac tggcgcccgggcagggcctgcggcgcggcgcctccctccgccatggctgccctccggaag aagctggtggtggtgggagccggcgcctgcggcaagacgagcccgctggtggtgttcagc cgcgaccacttcccggaggagtacgtgcccacggtgttcgagaactacgtggccgacgtg gaggtggacggccggcgggtggagctggcgctgtgggacacggccggccaggaggagcac gaccgcctgcggccgctgtcctacccggacaccgacgtcgtgctcctgtgcttcgccatc agcagcccggacagcctggagaacgtgccggccaagtgggccccggaggtccggcacttc tgccccggcgtgcccctcgtcctggtggggaacaagaaggacctgcggaacgacgcgggc accaggcgggcgctggcggcctggaagcaggagcccgtgcggcctgaggcaggcagggac gtggccagcaggattggcgccttcggctacctggagtgttcggcgaagaccaaagagggc gtgagggaggtgtttgagatggccacgagggctgctctgcacgccagacgcggcaagaag agtggtttaccaaagactgcaaaccggaagtcaccttgctacagcgtttag

Oryctolagus cuniculus (rabbit): 100348967 Help Entry 100348967         CDS       T03373                                  Definition (RefSeq) transforming protein RhoA-like   KO K04513   Ras homolog gene family, member A Organism ocu  Oryctolagus cuniculus (rabbit) Pathway ocu04014   Ras signaling pathway ocu04015   Rap1 signaling pathway ocu04022   cGMP-PKG signaling pathway ocu04024   cAMP signaling pathway ocu04062   Chemokine signaling pathway ocu04071   Sphingolipid signaling pathway ocu04072   Phospholipase D signaling pathway ocu04144   Endocytosis ocu04150   mTOR signaling pathway ocu04270   Vascular smooth muscle contraction ocu04310   Wnt signaling pathway ocu04350   TGF-beta signaling pathway ocu04360   Axon guidance ocu04510   Focal adhesion ocu04520   Adherens junction ocu04530   Tight junction ocu04611   Platelet activation ocu04621   NOD-like receptor signaling pathway ocu04625   C-type lectin receptor signaling pathway ocu04660   T cell receptor signaling pathway ocu04670   Leukocyte transendothelial migration ocu04722   Neurotrophin signaling pathway ocu04810   Regulation of actin cytoskeleton ocu04921   Oxytocin signaling pathway ocu04928   Parathyroid hormone synthesis, secretion and action ocu04972   Pancreatic secretion ocu05100   Bacterial invasion of epithelial cells ocu05132   Salmonella infection ocu05133   Pertussis ocu05135   Yersinia infection ocu05152   Tuberculosis ocu05163   Human cytomegalovirus infection ocu05200   Pathways in cancer ocu05203   Viral carcinogenesis ocu05205   Proteoglycans in cancer ocu05206   MicroRNAs in cancer ocu05210   Colorectal cancer ocu05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:ocu00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     100348967    04015 Rap1 signaling pathway     100348967    04310 Wnt signaling pathway     100348967    04350 TGF-beta signaling pathway     100348967    04072 Phospholipase D signaling pathway     100348967    04071 Sphingolipid signaling pathway     100348967    04024 cAMP signaling pathway     100348967    04022 cGMP-PKG signaling pathway     100348967    04150 mTOR signaling pathway     100348967  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     100348967   09144 Cellular community - eukaryotes    04510 Focal adhesion     100348967    04520 Adherens junction     100348967    04530 Tight junction     100348967   09142 Cell motility    04810 Regulation of actin cytoskeleton     100348967  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     100348967    04621 NOD-like receptor signaling pathway     100348967    04625 C-type lectin receptor signaling pathway     100348967    04660 T cell receptor signaling pathway     100348967    04670 Leukocyte transendothelial migration     100348967    04062 Chemokine signaling pathway     100348967   09152 Endocrine system    04921 Oxytocin signaling pathway     100348967    04928 Parathyroid hormone synthesis, secretion and action     100348967   09153 Circulatory system    04270 Vascular smooth muscle contraction     100348967   09154 Digestive system    04972 Pancreatic secretion     100348967   09156 Nervous system    04722 Neurotrophin signaling pathway     100348967   09158 Development and regeneration    04360 Axon guidance     100348967  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100348967    05206 MicroRNAs in cancer     100348967    05205 Proteoglycans in cancer     100348967    05203 Viral carcinogenesis     100348967   09162 Cancer: specific types    05210 Colorectal cancer     100348967   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     100348967   09171 Infectious disease: bacterial    05132 Salmonella infection     100348967    05135 Yersinia infection     100348967    05133 Pertussis     100348967    05152 Tuberculosis     100348967    05100 Bacterial invasion of epithelial cells     100348967   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     100348967  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ocu04131]     100348967   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ocu04147]     100348967    04031 GTP-binding proteins [BR:ocu04031]     100348967 Membrane trafficking [BR:ocu04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     100348967 Exosome [BR:ocu04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    100348967   Exosomal proteins of other body fluids (saliva and urine)    100348967   Exosomal proteins of colorectal cancer cells    100348967   Exosomal proteins of bladder cancer cells    100348967 GTP-binding proteins [BR:ocu04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     100348967 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf SRPRB Motif Other DBs NCBI-GeneID:  100348967 NCBI-ProteinID:  XP_008251595 UniProt:  G1TTV0 LinkDB All DBs Position Un AA seq 316 aa AA seqDB search MLGPHTASGHYCRCTHRTALSPCRHHGCYKYEVHTQLPVIPAVVHTAPCRLHTAIPRRPH TALTWRGEGKARRVSRSRSCRAPEQLAHVSSLVSLRDAPDWRPGWACGAAPPSAMAALRK KLVVVGAGACGKTSLLVVFSRDHFPEEYVPTVFENYVADVEVDGRRVELALWDTAGQEEH DRLRPLSYPDTDVVLLCFAISSPDSLENVPAKWAPEVRHFCPSVPLVLVGNKKDLRNDAG TRRALAAWKQEPVRPEAGRDVASRIGAFGYLECLAKTKEGVREVFEMATRAALHARRGKK SGLPKTANRKSPCYSV NT seq 951 nt NT seq  +upstreamnt  +downstreamnt atgttaggtccacacacagcttccggtcactactgccgttgtacacaccgcaccgcatta tctccatgccgccatcatggttgttataaatacgaggtccacacacagcttccggtcatt cctgccgttgtacacaccgcaccgtgccgtctccacacggccattccgcgccgccctcac actgccctcacttggcggggagaagggaaagcgcgccgcgtctcccgctcccggagctgc agggctcccgagcagctcgcgcacgtcagttccctcgtcagcctccgcgacgccccggac tggcgcccgggctgggcctgcggcgcggcgcctccctccgccatggctgccctccggaag aagctggtggtggtgggagccggcgcctgcggcaagacgagcctgctggtggtgttcagc cgcgaccacttcccggaggagtacgtgcccacggtgttcgagaactacgtggccgacgtg gaggtggacggccggcgggtggagctggcgctgtgggacacggccggccaggaggagcac gaccgcctgcggccgctgtcctacccggacaccgacgtcgtgctcctgtgcttcgccatc agcagcccggacagcctggagaacgtgccggccaagtgggccccggaggtccggcacttc tgccccagcgtgcccctcgtcctggtggggaacaagaaggacctgcggaacgacgcgggc accaggcgggcgctggcggcctggaagcaggagcccgtgcggcctgaggcaggcagggac gtggccagcaggattggtgccttcggctacctggagtgtttggcgaagaccaaagagggc gtgagggaggtgtttgagatggccacgagggctgctctgcacgccagacgcggcaagaag agtggtttaccaaagactgcaaaccggaagtcaccttgctacagcgtttag

Oryctolagus cuniculus (rabbit): 100356250 Help Entry 100356250         CDS       T03373                                  Definition (RefSeq) transforming protein RhoA-like   KO K04513   Ras homolog gene family, member A Organism ocu  Oryctolagus cuniculus (rabbit) Pathway ocu04014   Ras signaling pathway ocu04015   Rap1 signaling pathway ocu04022   cGMP-PKG signaling pathway ocu04024   cAMP signaling pathway ocu04062   Chemokine signaling pathway ocu04071   Sphingolipid signaling pathway ocu04072   Phospholipase D signaling pathway ocu04144   Endocytosis ocu04150   mTOR signaling pathway ocu04270   Vascular smooth muscle contraction ocu04310   Wnt signaling pathway ocu04350   TGF-beta signaling pathway ocu04360   Axon guidance ocu04510   Focal adhesion ocu04520   Adherens junction ocu04530   Tight junction ocu04611   Platelet activation ocu04621   NOD-like receptor signaling pathway ocu04625   C-type lectin receptor signaling pathway ocu04660   T cell receptor signaling pathway ocu04670   Leukocyte transendothelial migration ocu04722   Neurotrophin signaling pathway ocu04810   Regulation of actin cytoskeleton ocu04921   Oxytocin signaling pathway ocu04928   Parathyroid hormone synthesis, secretion and action ocu04972   Pancreatic secretion ocu05100   Bacterial invasion of epithelial cells ocu05132   Salmonella infection ocu05133   Pertussis ocu05135   Yersinia infection ocu05152   Tuberculosis ocu05163   Human cytomegalovirus infection ocu05200   Pathways in cancer ocu05203   Viral carcinogenesis ocu05205   Proteoglycans in cancer ocu05206   MicroRNAs in cancer ocu05210   Colorectal cancer ocu05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:ocu00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     100356250    04015 Rap1 signaling pathway     100356250    04310 Wnt signaling pathway     100356250    04350 TGF-beta signaling pathway     100356250    04072 Phospholipase D signaling pathway     100356250    04071 Sphingolipid signaling pathway     100356250    04024 cAMP signaling pathway     100356250    04022 cGMP-PKG signaling pathway     100356250    04150 mTOR signaling pathway     100356250  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     100356250   09144 Cellular community - eukaryotes    04510 Focal adhesion     100356250    04520 Adherens junction     100356250    04530 Tight junction     100356250   09142 Cell motility    04810 Regulation of actin cytoskeleton     100356250  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     100356250    04621 NOD-like receptor signaling pathway     100356250    04625 C-type lectin receptor signaling pathway     100356250    04660 T cell receptor signaling pathway     100356250    04670 Leukocyte transendothelial migration     100356250    04062 Chemokine signaling pathway     100356250   09152 Endocrine system    04921 Oxytocin signaling pathway     100356250    04928 Parathyroid hormone synthesis, secretion and action     100356250   09153 Circulatory system    04270 Vascular smooth muscle contraction     100356250   09154 Digestive system    04972 Pancreatic secretion     100356250   09156 Nervous system    04722 Neurotrophin signaling pathway     100356250   09158 Development and regeneration    04360 Axon guidance     100356250  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100356250    05206 MicroRNAs in cancer     100356250    05205 Proteoglycans in cancer     100356250    05203 Viral carcinogenesis     100356250   09162 Cancer: specific types    05210 Colorectal cancer     100356250   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     100356250   09171 Infectious disease: bacterial    05132 Salmonella infection     100356250    05135 Yersinia infection     100356250    05133 Pertussis     100356250    05152 Tuberculosis     100356250    05100 Bacterial invasion of epithelial cells     100356250   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     100356250  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ocu04131]     100356250   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ocu04147]     100356250    04031 GTP-binding proteins [BR:ocu04031]     100356250 Membrane trafficking [BR:ocu04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     100356250 Exosome [BR:ocu04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    100356250   Exosomal proteins of other body fluids (saliva and urine)    100356250   Exosomal proteins of colorectal cancer cells    100356250   Exosomal proteins of bladder cancer cells    100356250 GTP-binding proteins [BR:ocu04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     100356250 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf SRPRB Motif Other DBs NCBI-GeneID:  100356250 NCBI-ProteinID:  XP_008249359 UniProt:  G1TFK6 LinkDB All DBs Position Un AA seq 292 aa AA seqDB search MVVINTRSTHSFRSFLPLYTPHRAVSTRPFRAVLTLPSLGGEKGKRAASPAPGAAGLPSG SRTSVPPSASATPRTGARAGPAAGAAPPSAMAALRKKLVVVGAGACGKTSLLVVFSRDHF PEEYVPTVFENYVADVEVDGRRVELALWDTAGQEEHDRLRPLSYPDTDVVLLCFAISSPD SLENVPAKWAPEVRHFCPGVPLVLVGNKKDLRNDAGTRRVLAAWKQEPVRPEAGRDVASR IGAFGYLECSAKTKEGVREVFEMATRAALHARRGKKSGLPKTANRKSPCYSV NT seq 879 nt NT seq  +upstreamnt  +downstreamnt atggtggttataaatacgaggtccacacacagcttccggtcattcctgccgttgtacaca ccgcaccgtgccgtctccacacggccattccgcgccgtcctcacactgccctcacttggc ggggagaagggaaagcgcgccgcgtctcccgctcccggagctgcagggctcccgagcggc tcgcgcacgtccgttcccccgtcagcctccgcgacgccccggactggcgcccgggctggg cctgcggcgggcgcggcgcctccctccgccatggctgccctccggaagaagctggtggtg gtgggagccggcgcctgcggcaagacgagcctgctggtggtgttcagccgcgaccacttc ccggaggagtacgtgcccacggtgttcgagaactacgtggccgacgtggaggtggacggc cggcgggtggagctggcgctgtgggacacggccggccaggaggagcacgaccgcctgcgg ccgctgtcctacccggacaccgacgtcgtgctcctgtgcttcgccatcagcagcccggac agcctggagaacgtgccggccaagtgggccccggaggtccggcacttctgccccggcgtg cccctcgtcctggtggggaacaagaaggacctgcggaacgacgcgggcaccaggcgggtg ctggcggcctggaagcaggagcccgtgcggcctgaggcaggcagggacgtggccagcagg attggcgccttcggctacctggagtgttcggcgaagaccaaagagggcgtgagggaggtg tttgagatggccacgagggctgctctgcacgccagacgcggcaagaagagtggtttacca aagactgcaaaccggaagtcaccttgctacagcgtttag

DBGET integrated database retrieval system