KEGG   Oryctolagus cuniculus (rabbit): 100340811
Entry
100340811         CDS       T03373                                 

Gene name
MYD88
Definition
(RefSeq) myeloid differentiation primary response 88
  KO
K04729  myeloid differentiation primary response protein MyD88
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04010  MAPK signaling pathway
ocu04064  NF-kappa B signaling pathway
ocu04620  Toll-like receptor signaling pathway
ocu04621  NOD-like receptor signaling pathway
ocu05132  Salmonella infection
ocu05133  Pertussis
ocu05134  Legionellosis
ocu05135  Yersinia infection
ocu05140  Leishmaniasis
ocu05142  Chagas disease
ocu05143  African trypanosomiasis
ocu05144  Malaria
ocu05145  Toxoplasmosis
ocu05152  Tuberculosis
ocu05161  Hepatitis B
ocu05162  Measles
ocu05164  Influenza A
ocu05168  Herpes simplex virus 1 infection
ocu05169  Epstein-Barr virus infection
ocu05170  Human immunodeficiency virus 1 infection
ocu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100340811 (MYD88)
   04064 NF-kappa B signaling pathway
    100340811 (MYD88)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100340811 (MYD88)
   04621 NOD-like receptor signaling pathway
    100340811 (MYD88)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100340811 (MYD88)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100340811 (MYD88)
   05135 Yersinia infection
    100340811 (MYD88)
   05133 Pertussis
    100340811 (MYD88)
   05134 Legionellosis
    100340811 (MYD88)
   05152 Tuberculosis
    100340811 (MYD88)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100340811 (MYD88)
   05162 Measles
    100340811 (MYD88)
   05164 Influenza A
    100340811 (MYD88)
   05161 Hepatitis B
    100340811 (MYD88)
   05168 Herpes simplex virus 1 infection
    100340811 (MYD88)
   05169 Epstein-Barr virus infection
    100340811 (MYD88)
  09174 Infectious disease: parasitic
   05144 Malaria
    100340811 (MYD88)
   05145 Toxoplasmosis
    100340811 (MYD88)
   05140 Leishmaniasis
    100340811 (MYD88)
   05142 Chagas disease
    100340811 (MYD88)
   05143 African trypanosomiasis
    100340811 (MYD88)
SSDB
Motif
Pfam: Death TIR TIR_2
Other DBs
NCBI-GeneID: 100340811
NCBI-ProteinID: XP_002723915
Ensembl: ENSOCUG00000002417
LinkDB
Position
Un
AA seq 343 aa
MRPGPLPAAGRRGSAGRRFSESRGRRGGAGAGEEEARAGAAPREQLAMAAGGPDLSSEPP
ARSASSLPLAALNVRVRRRLALFLNVRTQVAADWSALAEEMGFEYLEIRQLETRPDPTGS
LLDAWQSRPGASVGRLLELLEALGRDDVLAELRPSIEEDCQKYIWKQQQEESEKPLQVAV
VGSSVPRTPELAGITTLDDPLGQVPERFDAFICYCPSDMQFVQEMIRQLEQTNYRLKLCV
SDRDVLPGACVWSIASELIEKRCRRMVVVVSDDYLQSKECDFQTKFALSLSPGAHQKRLI
PIKYKAMKKEFPSILRFITVCDYTNPCTKSWFWTRLAKALSLP
NT seq 1032 nt   +upstreamnt  +downstreamnt
atgaggccggggcccctccccgcggccggtcgacgcggttctgcggggcggcgcttctcg
gaaagccgaggccggcggggcggggcgggcgcaggggaagaggaagcgcgggccggcgcc
gcgccccgggagcagctcgccatggccgcgggaggccccgacctgagctccgagcccccc
gcgcgctccgcgtcctcgctgcccctggcggcgctcaacgtgcgcgtgcggcggcgcctg
gcgctgttcctgaacgtgcgcacgcaggtggcagccgactggagcgcgctggccgaggag
atgggcttcgagtacctggagatccggcagctggagacgcgccccgaccccacgggcagc
ctgctggacgcctggcagagccgccccggcgcctcggtgggccgactgctggagctgctg
gaggcgctgggccgcgacgacgtgctggccgagctgcgccccagcatcgaggaggactgc
cagaagtacatttggaagcagcagcaggaagaaagcgagaagcccctgcaggtggctgtg
gtaggcagcagtgtcccacggaccccggagctggccggcatcaccacgctggatgacccc
ctgggccaggtgcccgagcgcttcgacgccttcatctgctactgccccagcgacatgcag
tttgtgcaggagatgatccggcagctggagcagaccaactaccggctgaagctgtgcgtg
tctgaccgcgacgtcctgcccggcgcctgcgtctggtccatcgccagtgagctcatcgag
aagaggtgccgccggatggtggtggtcgtctcggacgattacctgcagagcaaggagtgt
gacttccagaccaagtttgccctcagcctctctccaggtgcccatcagaagcggctgatc
cccatcaagtacaaggccatgaagaaagagttccccagtatcctgcggttcatcaccgtg
tgtgactacaccaacccctgcaccaagtcctggttctggacccggctggccaaggccttg
tccctgccctga

DBGET integrated database retrieval system