KEGG   Oryctolagus cuniculus (rabbit): 100341599
Entry
100341599         CDS       T03373                                 

Gene name
SRC
Definition
(RefSeq) SRC proto-oncogene, non-receptor tyrosine kinase
  KO
K05704  tyrosine-protein kinase Src [EC:2.7.10.2]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu01521  EGFR tyrosine kinase inhibitor resistance
ocu01522  Endocrine resistance
ocu04012  ErbB signaling pathway
ocu04015  Rap1 signaling pathway
ocu04062  Chemokine signaling pathway
ocu04137  Mitophagy - animal
ocu04144  Endocytosis
ocu04360  Axon guidance
ocu04370  VEGF signaling pathway
ocu04510  Focal adhesion
ocu04520  Adherens junction
ocu04530  Tight junction
ocu04540  Gap junction
ocu04611  Platelet activation
ocu04613  Neutrophil extracellular trap formation
ocu04625  C-type lectin receptor signaling pathway
ocu04727  GABAergic synapse
ocu04750  Inflammatory mediator regulation of TRP channels
ocu04810  Regulation of actin cytoskeleton
ocu04912  GnRH signaling pathway
ocu04915  Estrogen signaling pathway
ocu04917  Prolactin signaling pathway
ocu04919  Thyroid hormone signaling pathway
ocu04921  Oxytocin signaling pathway
ocu04926  Relaxin signaling pathway
ocu05100  Bacterial invasion of epithelial cells
ocu05135  Yersinia infection
ocu05152  Tuberculosis
ocu05161  Hepatitis B
ocu05163  Human cytomegalovirus infection
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05168  Herpes simplex virus 1 infection
ocu05203  Viral carcinogenesis
ocu05205  Proteoglycans in cancer
ocu05219  Bladder cancer
ocu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100341599 (SRC)
   04015 Rap1 signaling pathway
    100341599 (SRC)
   04370 VEGF signaling pathway
    100341599 (SRC)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100341599 (SRC)
   04137 Mitophagy - animal
    100341599 (SRC)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100341599 (SRC)
   04520 Adherens junction
    100341599 (SRC)
   04530 Tight junction
    100341599 (SRC)
   04540 Gap junction
    100341599 (SRC)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100341599 (SRC)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100341599 (SRC)
   04613 Neutrophil extracellular trap formation
    100341599 (SRC)
   04625 C-type lectin receptor signaling pathway
    100341599 (SRC)
   04062 Chemokine signaling pathway
    100341599 (SRC)
  09152 Endocrine system
   04912 GnRH signaling pathway
    100341599 (SRC)
   04915 Estrogen signaling pathway
    100341599 (SRC)
   04917 Prolactin signaling pathway
    100341599 (SRC)
   04921 Oxytocin signaling pathway
    100341599 (SRC)
   04926 Relaxin signaling pathway
    100341599 (SRC)
   04919 Thyroid hormone signaling pathway
    100341599 (SRC)
  09156 Nervous system
   04727 GABAergic synapse
    100341599 (SRC)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100341599 (SRC)
  09158 Development and regeneration
   04360 Axon guidance
    100341599 (SRC)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100341599 (SRC)
   05203 Viral carcinogenesis
    100341599 (SRC)
  09162 Cancer: specific types
   05219 Bladder cancer
    100341599 (SRC)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100341599 (SRC)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100341599 (SRC)
   05152 Tuberculosis
    100341599 (SRC)
   05100 Bacterial invasion of epithelial cells
    100341599 (SRC)
  09172 Infectious disease: viral
   05161 Hepatitis B
    100341599 (SRC)
   05168 Herpes simplex virus 1 infection
    100341599 (SRC)
   05163 Human cytomegalovirus infection
    100341599 (SRC)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100341599 (SRC)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100341599 (SRC)
   01522 Endocrine resistance
    100341599 (SRC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ocu01001]
    100341599 (SRC)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100341599 (SRC)
Enzymes [BR:ocu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     100341599 (SRC)
Protein kinases [BR:ocu01001]
 Non-receptor tyrosine kinases
  SRC family
   100341599 (SRC)
Membrane trafficking [BR:ocu04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    100341599 (SRC)
 Endocytosis
  Clathrin-mediated endocytosis
   Kinases
    100341599 (SRC)
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    100341599 (SRC)
  Macropinocytosis
   Kinases
    100341599 (SRC)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase SH2 SH3_1 SH3_9 SH3_2
Other DBs
NCBI-GeneID: 100341599
NCBI-ProteinID: XP_017197123
Ensembl: ENSOCUG00000009585
LinkDB
Position
4
AA seq 612 aa
MGAGRASRGLRSGPSGPRCPLGASDENGEVTRLETQSGRGGAGPPVQGQDPRASGTGPWA
AARASPGTRASGAAAWSRPESAPRRGPTAPSPARRPPNKPASADGHRGPSAAFAPAAAEP
KLFGGFNSSDTVTSPQRAGPLAGGVTTFVALYDYESRTETDLSFKKGERLQIVNNTRKVD
VSQTWFTFRWLQREGDWWLAHSLSTGQTGYIPSNYVAPSDSIQAEEWYFGKITRRESERL
LLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFS
SLQQLVAYYSKHADGLCHRLTTVCPTSKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEV
WMGTWNGTTRVAIKTLKPGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVSEEPIYIVTEYM
SKGSLLDFLKGETGKYLRLPQLVDMAAQIASGMAYVERMNYVHRDLRAANILVGENLVCK
VADFGLARLIEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKGRV
PYPGMVNREVLDQVERGYRMPCPPECPESLHDLMCQCWRKEPEERPTFEYLQAFLEDYFT
STEPQYQPGENL
NT seq 1839 nt   +upstreamnt  +downstreamnt
atgggggccggcagagccagccgggggctgcggtccgggccatcgggaccccgctgccct
cttggggcctcagatgagaacggggaagtgacccgcctggagacacagagtgggagaggc
ggagctgggcctccagtccaaggccaagaccccagagcctctgggacaggaccatgggca
gcagcaagagcaagcccagggacgcgagccagcggcgccgcagcctggagccggcccgag
agcgccccacggaggggcccgacggcgccttccccagcacgcagaccccccaacaagccg
gcctccgccgacggccaccgcggccccagcgccgccttcgcccctgctgccgccgagccc
aaactcttcgggggcttcaactcttcggacaccgtcacctccccgcagagggccgggccg
ctggctggcggggtgaccaccttcgtggccctctacgactatgagtcccggacggagacc
gacctgtccttcaagaagggggagcggctgcagatcgtcaacaacacgaggaaggtggat
gtcagccagacctggttcacattcagatggctgcaaagggagggagactggtggctggcc
cactcgctcagcacgggacagaccggctacatccccagcaactacgtggcgccctccgac
tccatccaggccgaggagtggtacttcggcaagattaccaggcgggagtcggagcggtta
ctgctcaatgcagaaaacccaagggggaccttcctggtgcgcgagagtgagaccacgaaa
ggtgcctactgcctgtcagtgtcggacttcgacaacgccaagggcctcaacgtgaagcac
tacaagatccgcaagctggacagcggcggcttctacatcacctcccgcacgcagttcagc
agcctgcagcagctcgtggcctactactccaagcacgccgacggcctgtgccaccgcctc
accaccgtgtgccccacgtccaagccgcagactcagggcctggccaaggacgcctgggag
atcccccgcgagtcgctgcggctggaggtcaaactgggccagggctgcttcggcgaggtg
tggatggggacctggaacggcaccaccagggtggccatcaaaaccctgaagcccggcacc
atgtccccggaggccttcctgcaggaggcacaggtcatgaagaagctgcggcacgagaag
ctggtgcagctgtacgccgtggtgtccgaggagcccatctacatcgtcacagagtacatg
agcaaggggagcttgctggacttcctcaagggagagacgggcaagtacctccggctgccg
cagctggtggacatggctgcgcagatcgcctcaggcatggcgtacgtggagcggatgaac
tacgtgcaccgggacctccgagccgccaacatcctggtgggggagaacctggtgtgcaag
gtggctgacttcgggctggcccggctcatcgaagacaacgagtacacggcccggcaaggt
gccaagttccccatcaagtggacagctccggaggctgcactctatggccggttcaccatc
aagtcagacgtgtggtcctttggcatcctgctgacggagctcaccacaaagggacgggtg
ccctaccccgggatggtgaaccgcgaggtgctggaccaggtggagcggggctaccggatg
ccctgcccgcccgagtgccccgagtccctgcatgacctcatgtgccagtgctggcggaag
gagccggaggagcggcccaccttcgagtacctgcaggccttcctggaggactacttcacg
tccaccgagccccagtaccagcctggagagaacctatag

DBGET integrated database retrieval system