KEGG   Oryctolagus cuniculus (rabbit): 100341605
Entry
100341605         CDS       T03373                                 

Gene name
IRAK4
Definition
(RefSeq) interleukin 1 receptor associated kinase 4
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04010  MAPK signaling pathway
ocu04064  NF-kappa B signaling pathway
ocu04620  Toll-like receptor signaling pathway
ocu04621  NOD-like receptor signaling pathway
ocu04722  Neurotrophin signaling pathway
ocu05132  Salmonella infection
ocu05133  Pertussis
ocu05135  Yersinia infection
ocu05140  Leishmaniasis
ocu05142  Chagas disease
ocu05145  Toxoplasmosis
ocu05152  Tuberculosis
ocu05161  Hepatitis B
ocu05162  Measles
ocu05164  Influenza A
ocu05168  Herpes simplex virus 1 infection
ocu05169  Epstein-Barr virus infection
ocu05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100341605 (IRAK4)
   04064 NF-kappa B signaling pathway
    100341605 (IRAK4)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100341605 (IRAK4)
   04621 NOD-like receptor signaling pathway
    100341605 (IRAK4)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100341605 (IRAK4)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100341605 (IRAK4)
   05135 Yersinia infection
    100341605 (IRAK4)
   05133 Pertussis
    100341605 (IRAK4)
   05152 Tuberculosis
    100341605 (IRAK4)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100341605 (IRAK4)
   05162 Measles
    100341605 (IRAK4)
   05164 Influenza A
    100341605 (IRAK4)
   05161 Hepatitis B
    100341605 (IRAK4)
   05168 Herpes simplex virus 1 infection
    100341605 (IRAK4)
   05169 Epstein-Barr virus infection
    100341605 (IRAK4)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100341605 (IRAK4)
   05140 Leishmaniasis
    100341605 (IRAK4)
   05142 Chagas disease
    100341605 (IRAK4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ocu01001]
    100341605 (IRAK4)
Enzymes [BR:ocu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100341605 (IRAK4)
Protein kinases [BR:ocu01001]
 Serine/threonine kinases: TKL group
  IRAK family
   100341605 (IRAK4)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Pkinase_fungal Death
Other DBs
NCBI-GeneID: 100341605
NCBI-ProteinID: XP_002712673
Ensembl: ENSOCUG00000004103
UniProt: G1SL29
LinkDB
Position
8
AA seq 460 aa
MNKPISPSTYVRCLNVGLIRKLSDFIDPQEGWKKLAAAIKKPSGDDRYNQLHIRRFEALL
QTGKSPTCELLFDWGTTNCTVGDLVDLLIQNEFFAPASLLLPDALPKTVNTLPAKEAITA
QQKLIPFHDKGKTSVIPVQNLEKNCVLPDSSSPENKSLGVSDTRFHSFSFYELRSITNDF
DERPIARGGNKMGEGGFGVVYKGCLRNTPVAVKKLAAMVDISTEELKQQFEQEIKVMAKC
QHENLVQLLGFSKDGDDLCLVYVYMPNGSLLDRLLCLDDTAPLSWHTRCNIAQGAAAGIS
FLHENHHIHRDIKSANILLDKAFTAKISDFGLARASEKFAQTVMTSRIVGTTAYMAPEAL
RGEITPKSDIYSFGVVLLEIITGLPAVDEHREPQLLLDIKEEIEDEEKTIEDYVDTKMSD
AEPSSVESMYSVACQCLHEKKNKRPDIKKVQQLLQEMIPS
NT seq 1383 nt   +upstreamnt  +downstreamnt
atgaacaaacccatatcaccatcaacgtatgtgcgctgcctcaatgttggattgattcgg
aagctgtcagattttattgatcctcaggaaggatggaagaaattagccgcagctattaag
aaaccatctggggatgacagatacaatcaattacacatcaggagatttgaagcattactt
caaactggaaaaagtcccacgtgcgaattactgtttgattggggcacgacgaattgcaca
gttggtgatcttgtggatcttttgatccaaaatgagtttttcgctcctgcaagtcttttg
ctaccagacgctctccccaaaactgtcaacacattacctgctaaggaggctataacagct
cagcagaaactgattccttttcatgacaaaggcaagacatcagtgatacctgtacagaat
cttgaaaaaaactgtgtacttcctgactcctcaagtccagaaaataaaagtctaggagtt
agtgatacacgttttcacagcttctccttttatgaattgaggagcatcactaatgacttt
gacgaacgacccattgctcgtggtggtaacaagatgggtgaggggggctttggcgtggtg
tacaaaggctgcctgcgcaacactcccgtggcagtgaagaagctcgcagcaatggttgat
attagtactgaagaactgaaacaacagtttgaacaagaaataaaagtaatggcaaagtgc
cagcatgaaaacttggtacaactgcttggtttctcaaaggatggagatgatctctgcctc
gtgtatgtctacatgcccaatggctcattgctggacagattgttatgcctggatgataca
gcaccactttcatggcacacaagatgcaacatcgctcagggtgctgcagctggcatcagc
tttttacacgaaaatcatcatattcatagagatattaaaagtgcaaatatcttactagac
aaagccttcactgccaaaatctctgactttgggcttgcacgtgcatctgagaagtttgcc
cagacagtgatgaccagcagaattgtgggaacaacagcttacatggcgcctgaagctttg
cgaggagaaataacacccaaatctgacatctacagctttggagtggtgttactggaaata
ataactggacttccagctgtggatgaacaccgtgaacctcagttactactagacattaaa
gaagaaattgaagatgaagaaaagacaattgaagattatgtggatacgaagatgagtgat
gctgagccctcttcagttgaaagtatgtactctgttgcttgtcagtgtctgcatgaaaag
aaaaataagagaccagatattaagaaggttcaacagttgctgcaagagatgataccttcc
taa

DBGET integrated database retrieval system