KEGG   Oryctolagus cuniculus (rabbit): 100342324
Entry
100342324         CDS       T03373                                 

Gene name
CPSF4L
Definition
(RefSeq) cleavage and polyadenylation specific factor 4 like
  KO
K14404  cleavage and polyadenylation specificity factor subunit 4
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu03015  mRNA surveillance pathway
ocu05164  Influenza A
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    100342324 (CPSF4L)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    100342324 (CPSF4L)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:ocu03021]
    100342324 (CPSF4L)
   03019 Messenger RNA biogenesis [BR:ocu03019]
    100342324 (CPSF4L)
Transcription machinery [BR:ocu03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     100342324 (CPSF4L)
Messenger RNA biogenesis [BR:ocu03019]
 Eukaryotic type
  mRNA processing factors
   3' end processing
    Cleavage and polyadenylation specificity factor (CPSF) complex
     100342324 (CPSF4L)
SSDB
Motif
Pfam: zf-CCCH zf_CCCH_4 Torus zf-CCCH_3 zf-CCCH_2 zf-CCCH_4 zf-C3H1
Other DBs
NCBI-GeneID: 100342324
NCBI-ProteinID: XP_008269993
LinkDB
Position
19
AA seq 191 aa
MQEVIAGLERFTFTFEHDVEMQRGTGLLPFQGMDKSSSAVCNFFPKGPCAKETLCPFRHE
HGEKTVVCKHWLRGLCKKGDHCRFLHRYDATRMPECYFYSTFGDCNNKECSFLHVKSAVK
PRDCPWYEQGFCKNGPLCKYRHTRRTMCLRYLAGFCPEGPTCQFAHPKINLAFNPSCRQG
TGPSSGLGVRR
NT seq 576 nt   +upstreamnt  +downstreamnt
atgcaagaggtcattgccggcctggagcgcttcaccttcaccttcgagcacgatgtggag
atgcagaggggcacggggctcctgcccttccagggcatggacaagtcaagttcagctgtg
tgcaacttcttccctaagggcccgtgcgccaaagagacgctctgccccttccggcacgag
cacggggagaagacggtggtgtgcaaacactggttgcggggcctgtgcaagaagggtgac
cactgccggttcctgcaccgctacgacgccaccaggatgcccgagtgctacttctactcc
acgttcggtgactgcaacaacaaggagtgttccttcctccacgtgaagtcggctgtcaag
ccccgggactgtccttggtacgaacaaggtttctgcaagaatggccccctatgtaagtac
cgccacacccgcagaaccatgtgtctccgctacctcgctggcttctgccccgagggaccc
acatgccagtttgcccatcccaagatcaatcttgcattcaacccgagttgcaggcaggga
acagggcccagctcaggacttggggtccgacgttga

KEGG   Oryctolagus cuniculus (rabbit): 100346062
Entry
100346062         CDS       T03373                                 

Gene name
CPSF4
Definition
(RefSeq) cleavage and polyadenylation specific factor 4
  KO
K14404  cleavage and polyadenylation specificity factor subunit 4
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu03015  mRNA surveillance pathway
ocu05164  Influenza A
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    100346062 (CPSF4)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    100346062 (CPSF4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:ocu03021]
    100346062 (CPSF4)
   03019 Messenger RNA biogenesis [BR:ocu03019]
    100346062 (CPSF4)
Transcription machinery [BR:ocu03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     100346062 (CPSF4)
Messenger RNA biogenesis [BR:ocu03019]
 Eukaryotic type
  mRNA processing factors
   3' end processing
    Cleavage and polyadenylation specificity factor (CPSF) complex
     100346062 (CPSF4)
SSDB
Motif
Pfam: zf-CCCH zf_CCCH_4 Torus zf-CCCH_3 zf-CCCH_4 zf-CCHC zf-CCCH_2 zf-C3H1
Other DBs
NCBI-GeneID: 100346062
NCBI-ProteinID: XP_002721910
LinkDB
Position
Un
AA seq 244 aa
MQEIIASVDHIKFDLEIAVEQQLGAQPLPFPGMDKSGAAVCEFFLKAACGKGGMCPFRHI
SGEKTVVCKHWLRGLCKKGDQCEFLHEYDMTKMPECYFYSKFGECSNKECPFLHIDPESK
IKDCPWYDRGFCKHGPLCRHRHTRRVICVNYLVGFCPEGPSCKFMHPRFELPMGTTEQPP
LPQQTQPPSKQRAPQVIGVMQSQSSSAGNRGPRPLEQVTCYKCGEKGHYANRCTKGHLAF
LSGQ
NT seq 735 nt   +upstreamnt  +downstreamnt
atgcaggagatcatcgctagcgtggaccacattaagttcgacttggagatcgcggtggag
cagcagctcggggcgcagccgctgcccttccccggcatggacaaatccggagctgctgtc
tgcgagttcttcctgaaagctgcctgtggcaaagggggcatgtgcccattccgccacatc
agcggcgagaagacagttgtgtgcaaacactggctgcgtgggctgtgcaagaaaggggac
cagtgcgagttcctgcacgagtacgacatgaccaagatgcccgagtgctacttctattcc
aagttcggggagtgcagcaacaaggagtgccccttcctgcacatcgaccccgagtccaag
atcaaggactgcccctggtatgaccgcggcttctgcaagcacggtcccctgtgcaggcac
cggcacacgcggagagtcatctgtgtgaattacctcgtgggattctgcccggagggaccc
tcctgcaaattcatgcaccctcggtttgaactgcccatgggaaccacggagcagccccca
ctgccgcagcagacacagcctccaagcaagcagagagccccgcaggtcatcggggtcatg
cagagtcaaagtagcagtgctggcaaccggggaccccggccgctggagcaggtcacctgt
tacaagtgtggtgaaaaaggacactacgccaacagatgcaccaaagggcacttggccttt
ctcagtggacagtga

DBGET integrated database retrieval system