KEGG   Oryctolagus cuniculus (rabbit): 100343500
Entry
100343500         CDS       T03373                                 

Gene name
TRIM25
Definition
(RefSeq) tripartite motif containing 25
  KO
K10652  tripartite motif-containing protein 25 [EC:2.3.2.27]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04064  NF-kappa B signaling pathway
ocu04622  RIG-I-like receptor signaling pathway
ocu05164  Influenza A
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100343500 (TRIM25)
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    100343500 (TRIM25)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    100343500 (TRIM25)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ocu04121]
    100343500 (TRIM25)
Enzymes [BR:ocu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     100343500 (TRIM25)
Ubiquitin system [BR:ocu04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRIM/RBCC proteins
    100343500 (TRIM25)
SSDB
Motif
Pfam: PRY SPRY zf-RING_UBOX zf-C3HC4_4 zf-C3HC4 zf-C3HC4_2 zf-RING_2 zf-C3HC4_3 zf-RING_5 Prok-RING_4 Exonuc_VII_L C5HCH zf-RING_11 DUF1366 zinc_ribbon_4 U-box zf-RING_6
Other DBs
NCBI-GeneID: 100343500
NCBI-ProteinID: XP_008269480
LinkDB
Position
19
AA seq 637 aa
MAELLPLTEELSCSICLEPFKEPVTTPCGHNFCRSCLDETWAVQGPPFRCPQCRTSYQVR
PQLHKNTVLCSVVERLAIVEQARAPGDGWTPPVRAAAPSTVAQVACDHCLKEPAVKTCFV
CTASFCQEHLRPHLDSPAFRDHPLQPPVRDLQRRKCPQHNRLRDFFCPEHGECICHVCVI
EHKTCSPMSLSQASADLENKLRYKLTIMYSQINGASKALEDVQARQQGVQEATNRKIEQL
RQEYLEIKALIDASEASSTRKIKEEEKRVHSKLDTIHQVLLKKKSEIQALKEKIEDGLKE
GDEFEFLEKASKLQGIVTKPVYVPKVELDHELIHCVYQGTLDLKNELKRATRQLQERKPK
EAPGPGDSTDHTKKERSKPSHPGKKVSYDKKPKNPSADTVPPSPAPCPPAKIPIFGALGH
VVSLNPADAEATAKVALSAASSAAVKATELKAFLDKSRPELLEYSTKVILDYNTAHNKVA
LSEKYTVASVAEESQNYRPHPQRFTYCSQVLGLHCYKKGVHYWEVKLQKNNFCGVGICYG
SMGRQGPQSRLGRNSASWCVEWFNTKISAWHDNVEKTLPSTKATQVGVLLNCDHGFVIFF
AIAEKVHLLYKFKVDFTEAVYPAFWVFSAGATLSICF
NT seq 1914 nt   +upstreamnt  +downstreamnt
atggcggagctgctgcccttaaccgaagagctgtcgtgctccatctgcctggagcccttc
aaggagccggtcaccaccccgtgcggccacaacttctgccgctcgtgcctggacgagaca
tgggccgtccagggcccgccgttccgctgtcctcagtgccgcaccagctaccaggtgcgc
ccgcagctgcacaagaacacggtgctgtgctccgtggtcgagcggctcgcgatagtggag
caggcccgggcgcccggcgacggctggacgccgcccgtgcgcgccgcggcccccagcacg
gtcgcccaggtggcctgcgaccactgcctgaaggagcccgccgtgaagacgtgcttcgtg
tgcacggcctccttctgccaggagcacctgcggccgcacctcgacagccccgccttccgg
gaccacccgctgcagccgcccgtgcgcgatctgcagcgccgcaagtgtccccagcacaac
cgcctgcgggactttttctgcccggagcacggcgagtgcatctgtcacgtctgcgtgata
gaacacaagacctgctcgcccatgtccctgagtcaggccagcgctgacctggagaacaag
ctgaggtacaaactcaccatcatgtacagtcagatcaatggggcgtcgaaagcgctagag
gatgtgcaagccaggcagcagggtgtgcaggaggctacaaacaggaagatagagcagctg
cgacaagaatacctggaaatcaaggctctcatcgatgcctcggaggccagctcgactcga
aagataaaggaagaggagaagagagtgcacagcaagttggacaccattcaccaggtgctc
ctcaagaagaagagcgagatccaggccctgaaggagaagatcgaggacggcctcaaggag
ggggacgagtttgagtttctggagaaagcctcaaaactgcaaggaatcgtgacgaagcca
gtgtacgtccccaaggtggagctggatcatgagctgatacattgcgtctaccagggcacc
ttggacttaaaaaatgagctgaagcgggctaccaggcagctccaggagaggaagcccaag
gaggccccaggcccaggtgactctacagaccatacaaaaaaggaaaggagcaaaccctca
caccctgggaagaaggtgtcatatgacaagaaacccaagaacccttcagctgacactgtc
cctccgtctcctgccccttgcccacctgccaagattcccatcttcggagccctgggacac
gttgtgagtttgaacccagctgacgcagaggctacagccaaagttgccctctcagcagcg
agctcagcagctgtcaaggccaccgagctgaaggccttcttggacaagtccagacccgag
ctcctggagtattctacgaaagtcatcctggactacaacactgcccacaacaaggtggct
ctgtcagagaagtataccgtggcttccgtggctgaggagtctcagaattaccggccacat
ccccagaggttcacttattgctctcaggtgctgggcctgcactgctacaagaaaggggtg
cactactgggaggtgaagctgcagaagaacaacttctgcggggtaggcatctgctacggc
agcatgggacggcagggcccccagagccggcttggtcgcaacagtgcctcctggtgcgtg
gagtggttcaacaccaagatctcagcctggcatgacaacgtggagaaaactctgccctcc
accaaggccacgcaggtcggcgtgcttctcaactgtgaccacggctttgtcatcttcttt
gccattgccgagaaggtccacctgttgtataagttcaaggtggactttaccgaagccgtg
tacccagccttctgggtgttctctgctggtgccacgctctctatctgcttctag

DBGET integrated database retrieval system