KEGG   Oryctolagus cuniculus (rabbit): 100343560
Entry
100343560         CDS       T03373                                 

Gene name
IFIH1
Definition
(RefSeq) interferon induced with helicase C domain 1
  KO
K12647  interferon-induced helicase C domain-containing protein 1 [EC:3.6.4.13]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04622  RIG-I-like receptor signaling pathway
ocu05161  Hepatitis B
ocu05162  Measles
ocu05164  Influenza A
ocu05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    100343560 (IFIH1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05162 Measles
    100343560 (IFIH1)
   05164 Influenza A
    100343560 (IFIH1)
   05161 Hepatitis B
    100343560 (IFIH1)
   05168 Herpes simplex virus 1 infection
    100343560 (IFIH1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:ocu04054]
    100343560 (IFIH1)
Enzymes [BR:ocu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     100343560 (IFIH1)
Pattern recognition receptors [BR:ocu04054]
 Cytoplasmic pattern recognition receptors
  RIG-I-like receptors
   100343560 (IFIH1)
SSDB
Motif
Pfam: CARD_2 RIG-I_C RIG-I_C-RD Helicase_C ResIII DEAD CARD SWI2_SNF2 AAA_22 DUF3638 AAA_19
Other DBs
NCBI-GeneID: 100343560
NCBI-ProteinID: XP_002712267
Ensembl: ENSOCUG00000002863
UniProt: G1SIH5
LinkDB
Position
7
AA seq 1022 aa
MSNGYSADKKFLYLLSCFRARVKMYIQVEPVLDHLTFLPADVREQIHRTADTSGNVQAVE
LLLSTLEKQIWPQGWAREFVEALKSAGSRLAARYLNPELADLPSPSFENTHDECFQLLNL
LQPTLVDSLLVRDVLDKCVEEDLLTTEDRNRISAAENNGNESGVRELLKRIVQKENWFST
FLDVLRQTGNDKLAQELTGTEFLESNAEAENVSQEDGPEVQELLYSTADQPSPEKEGWDM
ENNSSESSFADSSVVSESDTSLAEGSVSCLDESLGHNSNMGSDSGTMGSDSDEDSAAVRR
SPEPELQLRSYQMEVAQPALEGKNIIICLPTGSGKTRVAVFIAKDHLDKKKKESNPGKVI
VLVNKVPLVEQLFRKEFKPFLKKWYRVIGLSGDTQLKISFPEVVKSHDVIISTAQILENS
LLNFENGEDAGVQLSDFSLLIIDECHHTNKEAVYNNIMRRYLKQKLKNNRLKKENKPVIA
LPQILGLTASPGVGGANKQAKAEEHILKICANLDAFTIKTVKENLDQLKDQMKEPCKKFA
IADDTREDPFKEKLLEIMTRIQTYCQMSPMSDFGTQHYEQWAIQMEKKAAKEGNRKDRVC
AEHLRKYNEALQINDTIRMIDAYNHLETFYNNEREKKLAVQEDASDESDNDDCGGNEDNF
NKPLEQDGTDRFLMALFFENKNMLKKLADNPEHENEKLIKLRNTIMEQYTRTEESARGII
FTKTRQSAYALSQWITENEKFAEVGVKAHHLIGAGHSSEFKPMTQNEQKEVISKFRTGKI
NLLIATTVAEEGLDIKECNVIIRYGLVTNEIAMVQARGRARADESTYILVGCSGSGVVER
ETVNDFREKMMYTAIHRVQNMKPEEYEHKILELQMQSIMEMKMKIKRSIAKHYKENPSLI
TFLCKNCSVPACSGADIHVIEKMHHVNMTQEFKKLYIVRESKAQKKNFADYKTNGEIICK
CGQDWGTMMVHKGLDLPCLKIRNFVVVFKTNSAKKQYKKWVELPITFPDLDYSEYCLLSD
ED
NT seq 3069 nt   +upstreamnt  +downstreamnt
atgtcgaatggttattccgcagacaagaagttcctctatctcctctcatgcttccgggcc
agagtgaaaatgtacatccaggtggagcctgtcctggaccacctgacctttctgcctgca
gatgtgagggaacagatccacaggacagccgacacttctgggaatgtgcaagcagttgaa
ctgctcctgagcaccttggagaagcagatctggccccagggctgggctcgcgagtttgtg
gaggccctgaagagcgctggcagccgtttagcagcccgctacctgaatcctgagctcgcc
gacctgccctcgccatcattcgagaacactcatgatgaatgcttccaactgctgaacctc
ctgcagcccacgctggtagacagccttctagttcgagatgtcttagataaatgcgtggag
gaggacctgttgaccactgaagacagaaatcggatctctgctgcagaaaacaatgggaat
gagtcaggggtacgagaactactaaaaaggattgtgcagaaagaaaactggttttccaca
tttctggatgttctccgtcaaacaggaaatgataaacttgcgcaagagttaacaggcacc
gagttcttggagagcaatgcagaggctgaaaatgtatcacaagaagatggtcctgaagtt
caagagctgctttattcaaccgcagatcagccaagtccagagaaagagggatgggacatg
gagaacaattcatcagagtcatcctttgcagattcttctgtggtttcagaatcagacaca
agtttggcagaaggaagtgtcagctgcttagatgaaagtcttggacataacagcaacatg
ggcagtgattcaggcaccatgggaagtgattcagatgaagacagtgcagcagtaagaaga
tcccctgagccagagctgcagcttaggtcttaccaaatggaagttgcccagccagccttg
gaagggaagaacatcatcatctgccttcctacagggagtgggaaaacacgagtggctgtt
ttcattgccaaggatcacttggacaagaagaaaaaggaatctaatccaggaaaagttata
gttcttgtcaataaggtaccattagttgaacagctctttcgcaaagaattcaaaccgttt
ttgaagaaatggtatcgtgttattggattaagtggtgatacccaactgaaaatatcattt
ccagaagttgtcaaatctcatgatgttattatcagtacagcccaaattcttgaaaactcc
cttttgaattttgaaaatggagaagatgctggtgtccaattgtcagacttttccctcctt
atcattgatgaatgtcatcataccaacaaagaagcagtctacaataacattatgaggcgt
tatttgaaacagaagttgaaaaataatagactcaagaaagaaaacaagccagtgattgcc
ctacctcagattctgggactaacagcttcacctggtgttggaggagccaacaagcaagcc
aaagccgaagaacacattcttaaaatatgtgccaatcttgatgcatttaccattaaaacc
gtgaaagaaaatcttgatcagctcaaagaccaaatgaaggagccatgcaagaagtttgca
attgcagatgacacccgagaggatccatttaaagagaagcttctagaaataatgacaagg
attcaaacttattgccagatgagtccaatgtcagattttggaactcaacattatgaacaa
tgggccattcaaatggaaaaaaaagctgcaaaagaaggaaatcgcaaagaccgtgtgtgt
gcagaacacttgaggaagtacaatgaggccctgcaaattaatgacacaattcggatgatt
gatgcatataatcaccttgaaactttctataataatgagagagaaaagaaactcgcagtc
caagaagatgctagtgatgagagtgataatgatgattgtggtggcaatgaagataatttt
aacaaaccattggaacaggatgggacagatagatttcttatggcattattttttgaaaac
aaaaacatgttgaaaaaactagctgacaacccagaacatgaaaatgaaaagctgatcaaa
ttaagaaacaccataatggaacaatacacgagaactgaggaatcagcacgaggaataatt
ttcacaaaaacacggcagagtgcttatgccctttcccagtggattactgaaaatgaaaaa
tttgcagaagtaggcgttaaagcccaccatcttattggagctggtcacagcagtgagttc
aagcccatgacacagaatgaacaaaaagaagtcattagtaaatttcgcactggaaaaata
aatctgcttatagctaccacagtggcagaagaaggtctggatatcaaagaatgtaatgtc
attattcgttacggtctcgtcactaatgaaattgccatggtccaggcccgtggtcgagcc
agagctgatgagagcacctacatcctggttggctgcagtggctcaggagttgttgaacgt
gagacagtgaatgattttcgagagaagatgatgtatacagctatacatcgtgttcaaaat
atgaaaccagaggagtatgagcataagattttggaattacagatgcaaagtataatggaa
atgaaaatgaaaataaagagaagtatcgcaaagcattacaaggaaaatccatcgttaata
actttcctctgcaaaaactgcagtgtgccagcctgctctggggcagatatccatgtgatt
gagaagatgcatcatgtcaacatgacacaagaattcaagaaactctacattgtgagagaa
agcaaagcacaaaagaagaactttgctgactataaaacaaatggagagattatctgcaaa
tgtggccaagactggggcacgatgatggtacacaaaggcttagatttgccttgtctcaaa
ataaggaattttgtagtagttttcaaaactaattcagcaaagaaacaatacaaaaagtgg
gttgaattacctatcacatttcctgatcttgactactcagaatactgtctcttaagtgat
gaagattag

DBGET integrated database retrieval system