KEGG   Oryctolagus cuniculus (rabbit): 100343572
Entry
100343572         CDS       T03373                                 

Gene name
KPNA5
Definition
(RefSeq) karyopherin subunit alpha 5
  KO
K15042  importin subunit alpha-6/7
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu05164  Influenza A
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    100343572 (KPNA5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ocu03036]
    100343572 (KPNA5)
Chromosome and associated proteins [BR:ocu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    100343572 (KPNA5)
SSDB
Motif
Pfam: Arm IBB HEAT_EZ HEAT_2 Arm_3 HEAT V-ATPase_H_C RICTOR_V Arm_2 Adaptin_N DUF3818
Other DBs
NCBI-GeneID: 100343572
NCBI-ProteinID: XP_002714809
Ensembl: ENSOCUG00000007812
LinkDB
Position
12
AA seq 539 aa
MDAMASPGKDNYRMKSYKNKALNPQEMRRRREEEGIQLRKQKREEQLFKRRNVSLPRNDE
SMLESPIQDPDITSTVPIPEEEVITSDMVQMIFSNNADQQLTATQKFRKLLSKEPNPPID
QVIQKPGVVQRFVKFLERNENCTLQFEAAWALTNIASGTFLHTKVVIETGAVPIFIKLLN
SEHEDVQEQAVWALGNIAGDNAECRDFVLNCEILPPLLELLTNSNRLTTTRNAVWALSNL
CRGKNPPPNFSKVSPCLSVLSRLLFSSDPDVLADVCWALSYLSDGPNDKIQAVIDSGVCR
RLVELLMHNDYKVISPALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSPKESIRKEAC
WTVSNITAGNRAQIQAVIDANIFPVLIEILQKAEFRTRKEAAWAITNATSGGTPEQIRYL
VALGCIKPLCDLLTVMDSKIVQVALNGLENILRLGEQESKQNEIGVNPYCALIEEAYGLD
KIEFLQSHENQEIYQKAFDLIEHYFGAEEDDPSIAPQVDENQQQFVFQQQEAPMEGFQL
NT seq 1620 nt   +upstreamnt  +downstreamnt
atggatgccatggctagtccagggaaagataactatagaatgaaaagttacaagaataaa
gcgctaaatcctcaagagatgaggagaagaagagaagaagaaggaatacagcttcgaaaa
caaaagagggaagaacagttgttcaaacgcagaaatgtctccttgcccagaaatgatgaa
tctatgctagaaagtcctatccaggatccagatatcacttccactgtacccattccagag
gaagaagttattaccagtgatatggttcagatgattttttctaataatgctgatcagcag
ctaacagcaacacagaaatttagaaagttgctttctaaagaacctaatccaccaatagac
caagttatacaaaagccaggagttgtacagagatttgtgaaatttcttgaaagaaacgaa
aattgtactttacaatttgaagctgcatgggcattaactaacatagcatccggaactttt
ctacataccaaagtagtgattgaaacaggggctgttccaatttttatcaaacttcttaat
tcagaacatgaagatgttcaggaacaagctgtttgggcacttggtaatattgctggtgat
aatgcagaatgcagagattttgttttgaactgtgaaatacttccacctcttttagagtta
ttaacaaattcaaacagacttacaacaaccagaaatgctgtatgggccctctcaaattta
tgtagaggcaaaaaccctcctccaaactttagtaaggtttcaccttgcttaagtgtacta
tcacgattattgtttagcagtgacccagatgtgttagcagatgtgtgttgggccctttct
tatctctctgatggacccaatgataaaattcaagctgtcattgattcaggagtctgtcga
agattggtggagcttttgatgcacaatgattataaagttatatcacctgcactaagagca
gttggtaacattgtgactggtgatgatattcagacacaggtaattttgaactgttctgca
ttgccctgtctcttacacttactgagtagcccaaaggaatcaataagaaaagaagcttgc
tggactgtttctaacatcactgctggaaatagagctcagattcaggctgttatagatgca
aatatttttcctgttttgattgagattcttcaaaaagcagagtttcgcactaggaaagaa
gcagcttgggctataactaatgcaacatcaggaggcactccggagcaaataaggtatttg
gtagccttaggctgcattaaaccactttgtgaccttttgactgttatggattccaaaata
gtacaagtggctttaaatggacttgaaaatatcttacgtcttggagaacaagaatccaaa
cagaatgaaataggtgttaatccctactgtgctctcattgaagaagcatatggtctggat
aaaattgaatttcttcaaagtcatgaaaatcaggaaatttaccagaaggcttttgatctt
attgaacattactttggtgcagaagaagatgatcccagcattgcacctcaggtggatgaa
aaccaacaacagtttgtatttcaacagcaagaagcaccaatggaagggtttcaactttga

KEGG   Oryctolagus cuniculus (rabbit): 100350359
Entry
100350359         CDS       T03373                                 

Gene name
KPNA6
Definition
(RefSeq) karyopherin subunit alpha 6
  KO
K15042  importin subunit alpha-6/7
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu05164  Influenza A
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    100350359 (KPNA6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ocu03036]
    100350359 (KPNA6)
Chromosome and associated proteins [BR:ocu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    100350359 (KPNA6)
SSDB
Motif
Pfam: Arm IBB Arm_3 HEAT_EZ HEAT_2 HEAT V-ATPase_H_C Arm_2 NUSAP
Other DBs
NCBI-GeneID: 100350359
NCBI-ProteinID: XP_002720679
Ensembl: ENSOCUG00000017669
LinkDB
Position
Un
AA seq 573 aa
MVTKSQPGFHSNFAVNSARRLGKPLGDSRFRLMKNHVSETMASPGKDNYRMKSYKNNALN
PEEMRRRREEEGIQLRKQKREQQLFKRRNVELINEEAAMFDSLLMDSYVSSTTGESVITR
EMVEMLFSDDSDLQLATTQKFRKLLSKEPSPPIDEVINTPGVVDRFVEFLKRNENCTLQF
EAAWALTNIASGTSQQTKIVIEAGAVPIFIELLNSDFEDVQEQAVWALGNIAGDSSVCRD
YVLNCSILNPLLTLLTKSTRLTMTRNAVWALSNLCRGKNPPPEFAKVSPCLPVLSRLLFS
SDSDLLADACWALSYLSDGPNEKIQAVIDSGVCRRLVELLMHNDHKVASPALRAVGNIVT
GDDIQTQVILNCSALPCLLHLLSSPKESIRKEACWTISNITAGNRAQIQAVIDANIFPVL
IEILQKAEFRTRKEAAWAITNATSGGTPEQIRYLVSLGCIKPLCDLLTVMDSKIVQVALN
GLENILRLGEQEGKRSGSGVNPYCGLIEEAYGLDKIEFLQSHENQEIYQKAFDLIEHYFG
VEDDDSSLAPQVDETQQQFIFQQPEAPMEGFQL
NT seq 1722 nt   +upstreamnt  +downstreamnt
atggtgactaaatcacagcctggttttcattccaactttgctgtcaactctgctcgaagg
ttgggaaagcctctgggagactccaggttcagactcatgaaaaaccacgtgtcagagacc
atggcgagcccagggaaagataattatcgaatgaagagctataagaacaatgccctaaac
cctgaggaaatgaggcgaagaagagaggaggagggcattcagctgcggaagcagaagcga
gagcaacaactttttaagcggagaaatgtggagctgattaatgaagaagctgccatgttt
gatagtctcctcatggactcctatgtgagctctaccactggggagagtgtaatcacaaga
gagatggtggaaatgctcttttctgatgattctgacctgcagttagcaaccacacagaaa
ttccggaaactgctctccaaagagcctagtcctccaatagatgaagttatcaacactcca
ggggtagtggatcggtttgtggagtttctgaagaggaatgaaaattgtacattacagttt
gaagctgcctgggctctgacaaacattgcctctggaacctcccagcaaaccaaaattgtc
attgaagcaggggccgtccccattttcatagagctgcttaactcggactttgaggatgta
caagaacaggctgtctgggcactgggaaacatagctggagacagctctgtttgccgggat
tacgtcttgaactgttccatcctgaatcctttattaacactccttaccaagtccacacga
ctgacaatgacacggaatgcagtctgggctctgtcaaacctctgccgagggaaaaatcca
cccccagagtttgcaaaggtctccccttgtctgcctgtgctgtctcgcctactcttcagc
agtgactcagacttactggcagatgcctgctgggccctctcttacctgtctgatggcccc
aatgagaagatccaggccgtcatagactctggagtctgccggagattggtggagcttctg
atgcacaatgatcacaaagtggcttcacctgccttgagagctgtgggtaacattgtcact
ggggatgacatccagacccaggtcattctcaactgttcagcccttccttgcctcctccac
ctactgagcagccccaaggagtcaatccggaaggaagcttgctggaccatttcaaatatt
actgctggcaatagggctcaaatacaggctgtcatagatgcaaatatcttccctgtgttg
attgaaatccttcagaaagcagagttccgaacaagaaaagaggctgcctgggccatcacc
aatgccacatcaggaggaacccctgagcagatcagatatctggtctcattgggctgcatc
aaacctctgtgtgacttgctgactgtgatggattcaaagattgtgcaagtggccctcaat
ggactggagaacatcctacggcttggagagcaggagggcaaacgcagcggctcaggggtc
aatccctactgtggtctcattgaggaagcctatggcttggataaaattgagtttctccag
agccatgagaaccaagagatctaccagaaggccttcgacctcattgagcactatttcggc
gtagaagacgatgatagcagcctggctccccaagtggatgaaacgcaacagcagttcatc
ttccagcagcctgaggcccccatggagggcttccagctataa

KEGG   Oryctolagus cuniculus (rabbit): 100351853
Entry
100351853         CDS       T03373                                 

Gene name
KPNA2
Definition
(RefSeq) karyopherin subunit alpha 2
  KO
K15043  importin subunit alpha-1/8
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu05164  Influenza A
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    100351853 (KPNA2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ocu03036]
    100351853 (KPNA2)
Chromosome and associated proteins [BR:ocu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    100351853 (KPNA2)
SSDB
Motif
Pfam: Arm IBB Arm_3 HEAT_EZ HEAT_2 HEAT V-ATPase_H_C Adaptin_N ECF-ribofla_trS Gcn1_N
Other DBs
NCBI-GeneID: 100351853
NCBI-ProteinID: XP_002719531
Ensembl: ENSOCUG00000015913
UniProt: G1TAI0
LinkDB
Position
19
AA seq 529 aa
MSTNENANSPAARLHRFKNKGKDSTEMRRRRIEVNVELRKAKKDDQMLKRRNVSSFPDDA
TSPLQENRNNQGTVHWSVDDIVKGITSNNLESQLQATQAARKLLSREKQPPIDNIIRAGL
IPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISE
QAVWALGNIAGDGSVFRDLVIKYGAIDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNK
NPAPPLDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIEMVVKTGVVPQLVK
LLGANDLPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMS
NITAGRQDQIQQVVNHGLVPFLVGVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCG
IIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHE
NESVYRASLNLIEKYFSIEEEEDQNVAPETTSEGYTFQVQDGAPGAFHF
NT seq 1590 nt   +upstreamnt  +downstreamnt
atgtccaccaatgagaatgccaactcaccggccgcccggctccacagattcaagaacaag
gggaaggacagcaccgaaatgagacggcgccgaatagaagtgaacgtggagctgaggaag
gccaagaaggatgaccagatgctgaagaggaggaacgtgagctcctttcccgacgatgcg
acttcgccgctgcaggaaaaccgcaacaaccagggcactgtacattggtctgttgatgac
attgtcaaaggcataaccagcaacaatttggaaagccagctccaagctacccaagctgct
aggaaactgctttccagggaaaaacagccccctatagacaacataatccgggctggtttg
attccaaaatttgtgtccttcttgggcagaactgattgtagccccattcagtttgaatct
gcctgggcgctcactaacattgcttctgggacctcagaacaaactaaggcggtggtggat
ggaggtgccatcccagcattcatttccctgttggcatctccccatgctcacatcagcgaa
caagctgtatgggctctagggaacattgcaggtgatggttcagttttccgagatttggtt
atcaagtatggtgcaattgacccactgttggctcttctggctgttcctgatatgtcctct
ttggcatgcggttacttacgtaatctgacatggacactttcaaacctttgtcgcaacaag
aatcctgcacccccattagatgccgttgagcagattcttcctactttagttcgtctcctg
catcacgatgatccggaagtgttagcagatacctgctgggcgatttcctatctcactgat
ggtccaaatgagcggattgaaatggttgtgaagacaggagttgtgccgcaactcgtgaag
cttctaggagctaatgatttgccaattgtgactcctgcgctaagagccatagggaatatt
gtcacagggacagatgaacagacacaggttgtgatagatgcgggagcacttgctgtcttt
cccagcctgctgactaaccccaaaactaacatccagaaggaggccacgtggacaatgtca
aacatcacagctgggcgtcaggaccagatacagcaagttgtgaatcacggattggtcccg
ttccttgttggtgttctctctaaggcagactttaagacacaaaaagaagcagtatgggct
gtaaccaactatacaagtggcggaacagttgaacagattgtgtaccttgttcactgtggt
ataatagaaccgttgatgaacctcttgaccgcaaaggataccaaaattattctggttatt
ctggatgccatttcaaatatcttccaggctgctgagaaattaggtgaaactgagaaactt
agtataatgattgaagaatgtggaggcttggataaaatagaagctcttcaaaaccatgag
aatgaatccgtgtatagggcttcattaaacttgattgagaagtacttctctatagaggaa
gaggaagatcagaatgttgcgccagagaccacctctgaaggctacaccttccaagtgcag
gatggggcgccgggcgcctttcacttctga

KEGG   Oryctolagus cuniculus (rabbit): 100353066
Entry
100353066         CDS       T03373                                 

Gene name
KPNA7
Definition
(RefSeq) karyopherin subunit alpha 7
  KO
K15043  importin subunit alpha-1/8
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu05164  Influenza A
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    100353066 (KPNA7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ocu03036]
    100353066 (KPNA7)
Chromosome and associated proteins [BR:ocu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    100353066 (KPNA7)
SSDB
Motif
Pfam: Arm HEAT_EZ IBB Arm_3 HEAT_2 HEAT Adaptin_N
Other DBs
NCBI-GeneID: 100353066
NCBI-ProteinID: XP_017193363
Ensembl: ENSOCUG00000001792
UniProt: G1SG50
LinkDB
Position
Un
AA seq 509 aa
MPTLDVPEERLRKFKYRGKEASVRRQQRVAVSLELRKARKEEQALKRRNITDCSPEPASE
KPTKGVSLSLDDIVRGVNSSDPLLCFQATQAARKMLSRERNPPLKPIIDAGLIPRLVEFL
KSSLHPHLQFEAAWALTNIASGTSEQTRAVVEGGAIQPLIELLSSPCVAVCEQAVWALGN
IAGDGPEFRDVVISSNAIPHLLALVSPTVPITFLRNITWTLSNLCRNKNPYPCEEAVKQL
LPVLLHLLQHQDSEILSDTCWAFSYLTDGCNERIGRVVDTGVLPRLVELMTSLELCILTP
SLRTVGNIVTGTDQQTQMAIDAGMLRVLPQLLRHPKSSIQKEAAWALSNVAAGPHQHIQQ
LIAYNLLPPLVALLKNGEFRVQKEAVWMVANFTMGATVNQLFQLLHSGVLEPLMRLLTAP
DVKIVLIILDVISYFLQEAEKLYEKDNLCLLIEELGGIDQIEALQLHENRQIAQTALSII
EKHFTEAEDDGIVLPVRDRDYKWRAFVEK
NT seq 1530 nt   +upstreamnt  +downstreamnt
atgcccaccttggacgtcccggaggagaggctgaggaagtttaagtaccggggcaaagag
gcatctgtgaggcggcagcagcgcgtggcagtcagcctggagctgcggaaggccaggaaa
gaggagcaggccttaaagagacggaacatcactgattgctcccccgagccagcttctgaa
aaacccaccaaaggggtgagcctctccctggatgacatagtcagaggtgtgaacagctca
gacccactgctttgtttccaggccacccaggccgccaggaaaatgctctcccgggaaagg
aaccctcccctaaagcccatcatcgatgcggggctcatccccaggctggtggagttcctg
aagtcatcgcttcacccccacctgcagttcgaggcagcctgggctctgaccaacatcgct
tccgggacctcggagcagacgcgagccgtcgtggaaggaggtgccatccagcctctgatc
gagctcctgtcttccccctgcgtggccgtgtgcgagcaggccgtgtgggctcttggtaac
atagccggcgatggcccagagttcagagatgttgttatttcgagcaacgccataccgcac
ctgctggccctggtttcaccgactgtaccgatcacatttctgcggaacatcacgtggacc
ttgtccaacctgtgccggaacaagaacccgtacccttgcgaggaagcggtgaagcagctg
ctgccggtcctcctgcacctcctgcagcaccaggacagcgagatcctctcggacacctgc
tgggccttctcctacctcaccgatggctgcaatgagcgcatcggccgagtggttgacacg
ggggtcttgcccaggctggtggagctcatgaccagcctggaactctgcatcttgactcct
tctctgcgcaccgtggggaacattgtcacgggaaccgatcagcagacccagatggccatc
gacgcaggcatgctgagggtgctgccccagctcctgaggcaccccaagtcctccatccag
aaggaggctgcctgggccctgagcaacgtggctgcaggcccccatcagcacatccagcag
ctgattgcttacaacttgctgcctcccttggtggctctgttgaaaaacggggagttcaga
gtccagaaagaggctgtctggatggtggccaacttcacaatgggggccaccgtgaaccag
ttgttccagctcctccactcgggggtcctggagcccctgatgaggctcctcactgcccca
gatgttaaaattgtcctcatcatcctcgatgtcatctcctacttcctccaggaggcagag
aagctgtacgagaaggacaacctgtgtctcctgatagaagaactcggcgggatagaccaa
atcgaggccttgcagctgcacgagaaccggcagatcgcccaaaccgctctgagcatcatc
gagaagcacttcacggaggcagaagatgatggcatcgttttacctgtccgggacagagac
tacaaatggagagcgttcgtagaaaaatga

KEGG   Oryctolagus cuniculus (rabbit): 100357334
Entry
100357334         CDS       T03373                                 

Gene name
KPNA1
Definition
(RefSeq) karyopherin subunit alpha 1
  KO
K23940  importin subunit alpha-5
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu05132  Salmonella infection
ocu05164  Influenza A
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100357334 (KPNA1)
  09172 Infectious disease: viral
   05164 Influenza A
    100357334 (KPNA1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ocu03036]
    100357334 (KPNA1)
Chromosome and associated proteins [BR:ocu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    100357334 (KPNA1)
SSDB
Motif
Pfam: Arm IBB Arm_3 HEAT_2 HEAT_EZ HEAT V-ATPase_H_C Arm_2 V-ATPase_H_N FmdE
Other DBs
NCBI-GeneID: 100357334
NCBI-ProteinID: XP_008265063
Ensembl: ENSOCUG00000002694
UniProt: G1SI36
LinkDB
Position
14
AA seq 538 aa
MSTPGKENFRLKSYKNKSLNPDEMRRRREEEGLQLRKQKREEQLFKRRNVATAEEETEEE
VMSDGGFHEAQINNMEMAPGGVITSDMIEMIFSNSPEQQLSATQKFRKLLSKEPNPPIDE
VISTPGVVARFVEFLKRKENCTLQFESAWVLTNIASGNSLQTRIVIQAGAVPIFIELLSS
EFEDVQEQAVWALGNIAGDSTMCRDYVLDCNILPPLLQLFSKQNRLTMTRNAVWALSNLC
RGKSPPPEFAKVSPCLNVLSWLLFVSDTDVLADACWALSYLSDGPNDKIQAVIDAGVCRR
LVELLMHNDYKVVSPALRAVGNIVTGDDIQTQVILNCSALQSLLHLLSSPKESIKKEACW
TISNITAGNRAQIQTVIDANIFPALISILQTAEFRTRKEAAWAITNATSGGSAEQIKYLV
ELGCIKPLCDLLTVMDSKIVQVALNGLENILRLGEQEAKRNGTGINPYCALIEEAYGLDK
IEFLQSHENQEIYQKAFDLIEHYFGTEDEDSSIAPQVDLSQQQYIFQQCEAPMEGFQL
NT seq 1617 nt   +upstreamnt  +downstreamnt
atgtcaaccccaggaaaagagaactttcgcttgaaaagctataagaacaaatctctgaat
cctgatgaaatgcgaaggaggagggaggaggaagggctacagctccgcaaacagaaaaga
gaagagcagttattcaagagaagaaatgttgctacagcagaagaagaaacagaagaagaa
gttatgtcagatggaggctttcatgaggcccagattaataacatggagatggccccgggt
ggtgttattacttctgacatgattgaaatgatattttcaaatagcccagagcaacagctt
tctgcaacacagaaattcagaaaactgctttcaaaagaacctaaccctcctatcgatgaa
gttatcagcacgcctggagtagtggccaggtttgtggagttcctcaaacgaaaagagaat
tgtacgttgcagtttgaatctgcttgggtactgacaaatattgcttcaggaaattctctt
cagacccggattgtgattcaggcaggagctgtgcctatcttcatagagttgctaagctca
gagtttgaagatgtccaggaacaggcagtctgggctctaggcaacattgctggagatagt
actatgtgcagggattatgtcttggactgcaatatccttcctcctcttttgcagttattt
tcaaagcaaaaccgcctgaccatgacccggaatgcagtatgggcattgtctaatctctgt
agagggaagagtccaccaccagaatttgcaaaggtttccccctgtctgaatgtgctttcc
tggttactgtttgtcagtgacactgatgtactggctgatgcctgctgggccctttcatat
ctatcagatggacccaatgataaaattcaagcagtcattgatgcaggagtgtgtaggaga
cttgtggagctactgatgcataatgattataaagtggtttctcctgctttgcgggctgtg
ggaaacattgtcacaggagatgatattcagacacaggtaattttgaattgctcagctttg
cagagtttattgcatttgttgagtagcccaaaggaatccatcaaaaaggaagcatgttgg
acaatatctaatatcacagctggaaatagggcacagatccagactgtgatagatgccaac
attttcccagccctcattagtatattacaaactgctgagtttcggacaagaaaagaagca
gcttgggccatcacaaatgcaacttctggaggatcagctgaacagatcaagtatctggta
gaactgggttgtatcaagccgctctgtgatctcctcacagtcatggactctaagattgtc
caggttgccctgaatggcttggaaaacatcctaaggcttggagaacaagaagccaaaagg
aacggcactggcattaatccttactgtgctttgattgaagaggcttatggtctggataaa
attgaattcttacagagtcatgaaaaccaagagatctaccagaaggcctttgatcttatt
gagcattactttgggaccgaagatgaggacagcagcattgcaccccaggttgaccttagc
cagcagcagtacatcttccagcagtgtgaggctcctatggaaggtttccagctttga

DBGET integrated database retrieval system