KEGG   Oryctolagus cuniculus (rabbit): 100343893
Entry
100343893         CDS       T03373                                 

Gene name
STAT1
Definition
(RefSeq) signal transducer and activator of transcription 1
  KO
K11220  signal transducer and activator of transcription 1
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04062  Chemokine signaling pathway
ocu04217  Necroptosis
ocu04380  Osteoclast differentiation
ocu04620  Toll-like receptor signaling pathway
ocu04621  NOD-like receptor signaling pathway
ocu04625  C-type lectin receptor signaling pathway
ocu04630  JAK-STAT signaling pathway
ocu04658  Th1 and Th2 cell differentiation
ocu04659  Th17 cell differentiation
ocu04917  Prolactin signaling pathway
ocu04919  Thyroid hormone signaling pathway
ocu04933  AGE-RAGE signaling pathway in diabetic complications
ocu04935  Growth hormone synthesis, secretion and action
ocu05140  Leishmaniasis
ocu05145  Toxoplasmosis
ocu05152  Tuberculosis
ocu05160  Hepatitis C
ocu05161  Hepatitis B
ocu05162  Measles
ocu05164  Influenza A
ocu05165  Human papillomavirus infection
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05168  Herpes simplex virus 1 infection
ocu05169  Epstein-Barr virus infection
ocu05200  Pathways in cancer
ocu05212  Pancreatic cancer
ocu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ocu05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100343893 (STAT1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100343893 (STAT1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100343893 (STAT1)
   04621 NOD-like receptor signaling pathway
    100343893 (STAT1)
   04625 C-type lectin receptor signaling pathway
    100343893 (STAT1)
   04658 Th1 and Th2 cell differentiation
    100343893 (STAT1)
   04659 Th17 cell differentiation
    100343893 (STAT1)
   04062 Chemokine signaling pathway
    100343893 (STAT1)
  09152 Endocrine system
   04917 Prolactin signaling pathway
    100343893 (STAT1)
   04935 Growth hormone synthesis, secretion and action
    100343893 (STAT1)
   04919 Thyroid hormone signaling pathway
    100343893 (STAT1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100343893 (STAT1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100343893 (STAT1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100343893 (STAT1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100343893 (STAT1)
  09163 Immune disease
   05321 Inflammatory bowel disease
    100343893 (STAT1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100343893 (STAT1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100343893 (STAT1)
  09172 Infectious disease: viral
   05162 Measles
    100343893 (STAT1)
   05164 Influenza A
    100343893 (STAT1)
   05161 Hepatitis B
    100343893 (STAT1)
   05160 Hepatitis C
    100343893 (STAT1)
   05168 Herpes simplex virus 1 infection
    100343893 (STAT1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100343893 (STAT1)
   05169 Epstein-Barr virus infection
    100343893 (STAT1)
   05165 Human papillomavirus infection
    100343893 (STAT1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100343893 (STAT1)
   05140 Leishmaniasis
    100343893 (STAT1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ocu03000]
    100343893 (STAT1)
Transcription factors [BR:ocu03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    100343893 (STAT1)
SSDB
Motif
Pfam: STAT_alpha STAT_int STAT_bind STAT1_TAZ2bind SH2 NPV_P10 TRPM_tetra Syntaxin-6_N
Other DBs
NCBI-GeneID: 100343893
NCBI-ProteinID: XP_002712392
Ensembl: ENSOCUG00000002455
UniProt: G1SHL8
LinkDB
Position
7
AA seq 750 aa
MSQWYELQQLDSKFLEQVHQLYDDSFPMEIRQYLAQWLENQDWEHAANDVSFATILFHDL
LSQLDDQYSRFSLENNFLLQHNIRKSKRNLQDNFQEDPIQMSMIIYNCLKEERKILENAQ
RFNQAQSGNIQSTVMLDKQKELDNKVRNVKEQVMNIEHEIKTLEDLQDEYDFKCKTLQNR
EHEANGVAKSDQKQEQLLLQKMYLMLDNKRKEIVHKMRELLNATELTQNALINDELVEWK
RRQQSACIGGPPNACLDQLQNWFTIVAESLQQVRQQLKKLEELEQKFTYEHDPITKNKQV
LWDRTFSLFQQLIQSSFVVERQPCMPTHPQRPLVLKTGVQFTVKLRLLVKLQELNYNLKV
KVLFDKDVNERNTVKGFRKFNILGTHTKVMNMEESTNGSLAAEFRHLQLKEQKNAGNRTN
EGPLIVTEELHSLSFETQLCQPGLVIDLETTSLPLVVISNVSQLPSGWASILWYNMLVAE
PRNLSFFLNPPCARWSQLSEVLSWQFSSVTKRGLNGDQLSMLGEKLLGPNAGLDGLIPWT
RFCKENISDKNFSFWLWIENILELIKKHLLCLWNDGCIMGFISKERERALLKDQQPGTFL
LRFSESSREGAITFTWVERSQNGGEPYFHAVEPYTKKELSAVTFPDIIRNYKVMAAENIP
ENPLKYLYPNIDKDHAFGKYYSRPKEGQEPMELDGPKGTGYIKTELISVSEVHPSRLQST
ENLLPMSPEEFDEVSRIMGPVEFDSMMNAV
NT seq 2253 nt   +upstreamnt  +downstreamnt
atgtctcagtggtatgagcttcagcagctcgactctaaattcctggagcaggttcaccag
ctctatgatgacagttttcccatggaaattcgacagtacctggcacagtggctagaaaat
caggactgggagcacgccgccaatgatgtttcgtttgccaccatcctcttccatgacctg
ctctcgcagctggacgatcagtacagtcgcttctctctggagaacaattttctgttgcag
cataacataaggaaaagcaagcggaaccttcaggacaattttcaagaagaccccatacag
atgtctatgatcatctataactgtctgaaggaggagcggaagattctggaaaatgcgcag
agattcaatcaggcccagtcggggaatattcagagcaccgtgatgttagacaagcagaag
gagcttgacaacaaagtcagaaatgtgaaggagcaagtgatgaatatagagcacgaaatc
aagaccctggaagatctacaagatgagtatgacttcaagtgcaaaaccttgcagaaccga
gaacatgaagccaatggtgtggcaaagagcgaccagaagcaagagcagctgctgctccag
aagatgtatttaatgctggacaacaagaggaaggaaatcgttcacaagatgagagagttg
ttgaatgccactgagctcacccagaatgccctgattaacgatgagctcgtggagtggaag
cggaggcagcagagcgcctgtatcgggggcccgcccaacgcgtgcctggaccagctgcag
aactggttcaccatagtggcagagagtctgcagcaggttcgtcagcagcttaaaaagctg
gaggaattggaacagaaattcacctatgaacatgaccctatcaccaagaacaaacaggtg
ctatgggatcgcaccttcagtctcttccagcagctcattcagagctcgttcgtggtggag
agacagccttgcatgcccactcatcctcagagaccgctggtcttgaagactggggtgcag
ttcactgtgaagctgaggctgttggtgaaactgcaagagctgaattataacttgaaagtc
aaagtcctgtttgacaaagacgtgaatgagagaaacacagtgaaaggattcaggaagttc
aacatcctgggcacacacacgaaggtgatgaacatggaggagtccaccaacggaagtctg
gcggcggaattccgacacctgcaactgaaagaacagaagaacgctggcaacaggactaac
gagggtcctctaattgtaaccgaagagcttcactccctaagttttgaaacccagctgtgc
cagcctggcctggtcattgacctcgagacgacttccctgcccctcgtggtgatctccaac
gtcagccagctcccgagcggttgggcgtccatcctgtggtacaacatgctggtggcggag
cctaggaatctgtccttcttcctgaacccaccgtgtgcgcgatggtctcagctctcggag
gtactgagttggcagttttcctctgtcaccaaacgcggcctcaacggggaccagctgagc
atgctgggagagaagctacttggtcctaatgccggcctcgatggtcttattccgtggacg
aggttctgcaaggaaaatataagtgacaaaaatttctccttctggctgtggattgaaaac
atcctagaactgattaaaaagcacctgctgtgtctatggaatgatgggtgcatcatgggc
ttcatcagcaaggagcgagagcgcgccctgctgaaggaccagcagcccggcacgttcctg
ctgcggttcagcgagagcagccgggaaggcgccatcacgttcacgtgggtggagcggtcc
cagaacggaggcgaaccttatttccatgcggttgagccctacacgaagaaagaactttct
gctgtgactttccctgatatcatccgcaattacaaagtcatggctgccgagaatattcct
gagaaccccctgaagtatctgtatccaaatattgacaaggaccatgccttcgggaagtat
tactccaggccaaaggaagggcaagaacccatggaacttgacggccccaaaggaactgga
tacatcaagactgagttgatttctgtgtctgaagttcacccttctagactccagagcaca
gaaaacctgctgcccatgtctcctgaggagtttgatgaggtgtctcggataatgggccct
gtagaattcgacagtatgatgaacgcagtatag

KEGG   Oryctolagus cuniculus (rabbit): 100344467
Entry
100344467         CDS       T03373                                 

Gene name
STAT2
Definition
(RefSeq) signal transducer and activator of transcription 2
  KO
K11221  signal transducer and activator of transcription 2
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04062  Chemokine signaling pathway
ocu04217  Necroptosis
ocu04380  Osteoclast differentiation
ocu04621  NOD-like receptor signaling pathway
ocu04625  C-type lectin receptor signaling pathway
ocu04630  JAK-STAT signaling pathway
ocu05160  Hepatitis C
ocu05161  Hepatitis B
ocu05162  Measles
ocu05164  Influenza A
ocu05165  Human papillomavirus infection
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05168  Herpes simplex virus 1 infection
ocu05169  Epstein-Barr virus infection
ocu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100344467 (STAT2)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100344467 (STAT2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100344467 (STAT2)
   04625 C-type lectin receptor signaling pathway
    100344467 (STAT2)
   04062 Chemokine signaling pathway
    100344467 (STAT2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100344467 (STAT2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100344467 (STAT2)
  09172 Infectious disease: viral
   05162 Measles
    100344467 (STAT2)
   05164 Influenza A
    100344467 (STAT2)
   05161 Hepatitis B
    100344467 (STAT2)
   05160 Hepatitis C
    100344467 (STAT2)
   05168 Herpes simplex virus 1 infection
    100344467 (STAT2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100344467 (STAT2)
   05169 Epstein-Barr virus infection
    100344467 (STAT2)
   05165 Human papillomavirus infection
    100344467 (STAT2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ocu03000]
    100344467 (STAT2)
Transcription factors [BR:ocu03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    100344467 (STAT2)
SSDB
Motif
Pfam: STAT_alpha STAT_bind STAT_int SH2
Other DBs
NCBI-GeneID: 100344467
NCBI-ProteinID: XP_017197430
LinkDB
Position
4
AA seq 776 aa
MAQWEMLQDLDGPYQDLLHQLYSHSLLPVDIRQHLAAWIEDQNWREAVLGNDDSKATMLF
FHFLEQVNFECGRCSQDPECLLLQHNLRKFYRDLQAFPRGPTQLAEMMFNLLLEEEKILN
QAQRAQMEPGQPALGAPVESQQHDIESRLLDLKAMMEKLVKSISQLADLQDVFRFRYNTQ
AQGKAACSDPHWNRQQQLLQETLNELDKRRKEVLDDSKALLGRLTTLVDLLLPELDEWKA
QQQKACIGALQQPGLQQLEKWFTEGAKLLFHLWKLTKELQVTHLVTYENDPLIKGVDLQK
SQILELLKRLLYRAFVVETQPCMPQVLHRPLIIKTGSKFTARTRLLVRLQEGSESLTVEV
SIDRNPPQLQGFRKFNILTSNQKTLTPERGQSQGLVWDFGHLSLVEQRSGGSGKGSNKGT
LAVTEELHVISFTVKYTYQDLKLELRTDTLPVVVISNMNQLSIAXASILWFNLLSPNPQN
QQFFCSPPKAPWSLLGPALSWQFSSYVHRGLNPEQLAMLKDKLFGKSARNEDPLLSWADF
TKRESPPGKIPFWTWLDKILELVHDHLKELWKDGRIMGFVNRSQERRLLKKMVSGTFLLR
FSESSEGGITCSWVEHQEDDKVLICSVQPYTKEVLQSLPLTEIIRHYQLLTDENIPENPL
RFLYPRIPRDEAFGCYYQEKVNLQERRKYLKHRLIVVSNRQLDERQPPPLPLPLELEPKL
EPLELEPLELEPGLAPGPELALSLELGTLLETGLDLGLEPTLGLVPQSMPEPDMLP
NT seq 2331 nt   +upstreamnt  +downstreamnt
atggcacagtgggagatgctgcaggatctggacggcccatatcaggatctgctacaccag
ctgtactcacatagcctcctgccagtggacattcgacagcacttggctgcctggattgaa
gaccagaactggcgagaagctgtgctgggcaacgatgattctaaggctaccatgctgttc
ttccacttcttggagcaagtgaacttcgagtgtggccgctgcagtcaagaccctgagtgc
ttgttgctgcaacacaacttgagaaaattctaccgggaccttcaggccttccccagaggc
cctacccaattggctgaaatgatgtttaacctccttttggaagaagaaaaaattctgaat
caggctcagagggcccagatggagccaggccagccggctctgggagcacctgtggagagc
cagcagcatgatatcgagtcccggctcctggatttgaaggctatgatggagaagctggtg
aagtccatcagccagctggcagacctgcaggacgtcttccgcttccgctacaacacacag
gcccaagggaaggcagcctgttcggaccctcattggaacagacagcagcagctactgcaa
gaaaccctcaatgaactggacaaaaggagaaaggaggtgctggatgactccaaagcactg
ttaggccgactgactaccctcgtcgacctgctgctgccggagctggatgagtggaaagcc
cagcagcaaaaagcctgcattggagccctccagcagcctgggctgcaacagctggagaag
tggttcacagagggagccaagctgctgtttcacctgtggaagctaactaaggagctgcag
gtgacccacctggttacctacgagaatgaccctctgatcaaaggtgtagacctgcagaag
tcccagatcctagaactgctgaagcgtctgctctacagagcctttgtggtcgaaacccag
ccctgcatgccccaggttctccatcgacccctcatcatcaagacagggagcaagttcact
gcccgaacaaggctgctggtcagactccaggaaggcagtgagtccctgaccgtggaagtc
tccattgacaggaatcctcctcaattacaaggcttccggaagttcaacattctgacctca
aaccagaaaacgttgacacccgaaagggggcagagtcagggcttagtttgggactttggc
cacttgtccctggtggagcagcgttcaggcggctcagggaagggcagcaataaggggaca
ctggctgtcacagaggagctgcacgtcatcagcttcacggtcaaatacacctaccaggat
ctgaagctggagctgagaacagacaccctccctgtggtagtcatctccaacatgaaccag
ctctccattgcctgagcctccattctctggttcaatcttctcagccccaacccccagaac
cagcagttcttctgcagccccccgaaggccccctggagcttgctgggccccgctctcagt
tggcagttctcgtcctatgttcaccggggcctcaacccggagcagctcgccatgctcaag
gacaagctgtttgggaagagcgctaggaatgaggacccattgttgtcctgggccgacttc
accaagcgagaaagcccccctggcaagatccccttctggacgtggctggacaaaattcta
gagctggtgcatgaccacctcaaggagctctggaaagacgggcgcatcatgggctttgtg
aatcgcagccaagagcgccggctgctgaagaagatggtgtctggcactttccttctgcgc
ttcagtgaatcgtcagaagggggcattacctgctcctgggtggagcaccaggaggacgat
aaggtgctcatctgctcagtgcagccctacaccaaggaggtgctgcagtcgctcccgctg
actgaaatcatccgccactaccagctgctcaccgacgagaacatccccgagaacccactg
cgcttcctctacccccgaatcccccgcgatgaggcttttggatgctactaccaggaaaaa
gttaatctccaggaacggaggaaatacctgaaacataggctcattgtggtctccaacaga
cagttggatgagcggcagccaccgccactaccactgccactggagctggagccaaaattg
gagccgttagagctggagccgttagagctggagccggggctagcaccaggcccggagcta
gcgttaagcctggagttagggaccctgctggagacagggctggacctggggctggagccc
acgctgggcctggtgccacagagcatgccagagccagacatgcttccgtga

DBGET integrated database retrieval system