KEGG   Oryctolagus cuniculus (rabbit): 100344550
Entry
100344550         CDS       T03373                                 

Definition
(RefSeq) protein mago nashi homolog
  KO
K12877  protein mago nashi
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu03013  RNA transport
ocu03015  mRNA surveillance pathway
ocu03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    100344550
  09122 Translation
   03013 RNA transport
    100344550
   03015 mRNA surveillance pathway
    100344550
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ocu03019]
    100344550
   03041 Spliceosome [BR:ocu03041]
    100344550
Messenger RNA biogenesis [BR:ocu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    EJC complex
     100344550
Spliceosome [BR:ocu03041]
 Complex C
  Other components
   EJC/TREX
    100344550
SSDB
Motif
Pfam: Mago_nashi
Other DBs
NCBI-GeneID: 100344550
NCBI-ProteinID: XP_017196279
LinkDB
Position
2
AA seq 82 aa
MIRKEAYVHQSVMEELKRIIDDSEITKEDYALWSSLDRVGQQEFEIVIGDKHISFTTSKM
DCLTDINQSKDPEDLLVFYYLL
NT seq 249 nt   +upstreamnt  +downstreamnt
atgatcagaaaagaagcttatgtacaccagagtgtaatggaagaactgaagaggattatt
gatgatagtgaaattacaaaagaagactatgctctgtggtcttcccttgacagggttggc
caacaggagtttgaaattgtaattggggataaacatatttcttttacaacatcaaaaatg
gattgtcttactgatataaaccagtcaaaggatcctgaagacctcctagtattttactat
ttgttatag

KEGG   Oryctolagus cuniculus (rabbit): 100344696
Entry
100344696         CDS       T03373                                 

Gene name
MAGOHB
Definition
(RefSeq) mago homolog B, exon junction complex core component
  KO
K12877  protein mago nashi
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu03013  RNA transport
ocu03015  mRNA surveillance pathway
ocu03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    100344696 (MAGOHB)
  09122 Translation
   03013 RNA transport
    100344696 (MAGOHB)
   03015 mRNA surveillance pathway
    100344696 (MAGOHB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ocu03019]
    100344696 (MAGOHB)
   03041 Spliceosome [BR:ocu03041]
    100344696 (MAGOHB)
Messenger RNA biogenesis [BR:ocu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    EJC complex
     100344696 (MAGOHB)
Spliceosome [BR:ocu03041]
 Complex C
  Other components
   EJC/TREX
    100344696 (MAGOHB)
SSDB
Motif
Pfam: Mago_nashi
Other DBs
NCBI-GeneID: 100344696
NCBI-ProteinID: XP_002722203
LinkDB
Position
Un
AA seq 178 aa
MTHLACADDVTAGRREARWPGFGRACLGAKMSMASDFYLRYYVGHKGKFGHEFLEFEFRP
DGKLRYANNSNYKNDVMIRKEAYVHKSVMEELKRIIDDSEITKEDDALWPPPDRVGRQEL
EIVIGDEHISFTTSKIGSLIDVNQSKDPEGLRVFYYLVQDLKCLVFSLIGLHFKIKPI
NT seq 537 nt   +upstreamnt  +downstreamnt
atgacgcacttagcctgcgcggatgacgtcactgccgggcgccgggaggcacgttggccg
ggctttgggcgggcttgtctgggagcaaagatgtctatggctagtgatttctacctgcgc
tactatgtagggcacaaaggcaagtttggacacgagtttctggagttcgagtttcggccg
gacggaaagcttagatatgccaataatagtaattacaaaaatgatgtcatgatcagaaaa
gaggcttacgtgcacaagagtgtaatggaagaactgaagaggattattgatgacagtgaa
attacaaaagaagatgatgccttatggcctccccctgacagggttggccgacaggagctt
gaaattgttattggtgatgaacacatttcttttacaacatcaaaaataggttctcttatt
gatgtaaatcagtcaaaggatcctgaaggccttcgtgtgttttactatttggtacaggat
ctgaaatgtttagttttcagtctcattggattacacttcaagattaaaccaatttaa

KEGG   Oryctolagus cuniculus (rabbit): 100354873
Entry
100354873         CDS       T03373                                 

Gene name
MAGOH
Definition
(RefSeq) mago homolog, exon junction complex core component
  KO
K12877  protein mago nashi
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu03013  RNA transport
ocu03015  mRNA surveillance pathway
ocu03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    100354873 (MAGOH)
  09122 Translation
   03013 RNA transport
    100354873 (MAGOH)
   03015 mRNA surveillance pathway
    100354873 (MAGOH)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ocu03019]
    100354873 (MAGOH)
   03041 Spliceosome [BR:ocu03041]
    100354873 (MAGOH)
Messenger RNA biogenesis [BR:ocu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    EJC complex
     100354873 (MAGOH)
Spliceosome [BR:ocu03041]
 Complex C
  Other components
   EJC/TREX
    100354873 (MAGOH)
SSDB
Motif
Pfam: Mago_nashi
Other DBs
NCBI-GeneID: 100354873
NCBI-ProteinID: XP_002715134
Ensembl: ENSOCUG00000001880
UniProt: G1SGB7
LinkDB
Position
13
AA seq 146 aa
MESDFYLRYYVGHKGKFGHEFLEFEFRPDGKLRYANNSNYKNDVMIRKEAYVHKSVMEEL
KRIIDDSEITKEDDALWPPPDRVGRQELEIVIGDEHISFTTSKIGSLIDVNQSKDPEGLR
VFYYLVQDLKCLVFSLIGLHFKIKPI
NT seq 441 nt   +upstreamnt  +downstreamnt
atggagagtgacttttacctgcgctactacgtgggtcacaagggcaagttcggccacgag
ttcctggagtttgagttccgacctgacgggaaattgagatacgccaacaacagtaattac
aaaaatgatgtcatgatcagaaaagaggcttatgtacataaaagtgtgatggaggaactg
aagagaataattgatgacagtgaaattaccaaagaagatgatgctttgtggcctcctcct
gaccgagtgggccggcaggagcttgaaatcgttattggtgatgaacacatttctttcaca
acatcgaaaattggttcccttattgatgtcaatcagtccaaggacccagaaggcttacga
gtattttattatcttgtccaggacctgaagtgtttggtcttcagtcttattggattacac
ttcaagattaaaccaatctag

DBGET integrated database retrieval system