KEGG   Oryctolagus cuniculus (rabbit): 100344881
Entry
100344881         CDS       T03373                                 

Gene name
RNPS1
Definition
(RefSeq) RNA binding protein with serine rich domain 1
  KO
K14325  RNA-binding protein with serine-rich domain 1
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu03013  RNA transport
ocu03015  mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    100344881 (RNPS1)
   03015 mRNA surveillance pathway
    100344881 (RNPS1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ocu03019]
    100344881 (RNPS1)
Messenger RNA biogenesis [BR:ocu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    EJC complex
     100344881 (RNPS1)
SSDB
Motif
Pfam: RRM_1 RRM_3 RRM_5 RRM_7 Nup35_RRM_2 RRM_occluded Macoilin LAP1C
Other DBs
NCBI-GeneID: 100344881
NCBI-ProteinID: XP_017195076
UniProt: A0A5F9DRT1
LinkDB
Position
Un
AA seq 305 aa
MDLSGVKKKSLLGVKENNKKSSTRAPSPTKRKDRSDEKSKDRSKDKGATKESSEKDRGRD
KARKRRSASSGSSSTRSRSSSSSSSGSSTSTGSSSGSSSSSASSRSGSSSSSRSSSSSSS
SGSPSPSRRRHDNRRRSRSKSKPPKRDEKERKRRSPSPKPTKVHIGRLTRNVTKDHIMEI
FSTYGKIKMIDMPVDRMHPHLSKGYAYVEFENPDEAEKALKHMDGGQIDGQEITATAVLA
PWPRPPPRRFSPPRRMLPPPPMWRRSPPRMRRRSRSPRRRSPVRRRSRSPGRRRHRSRSS
SNSSR
NT seq 918 nt   +upstreamnt  +downstreamnt
atggatttatcaggagtgaaaaagaagagcttgctaggagtcaaagaaaataataaaaag
tccagcactagggctccctctcctaccaagcgcaaagaccgctctgacgagaagtccaag
gaccgctccaaagataaaggggccaccaaggagtccagtgagaaggaccgcggccgggac
aaggcgcggaagcggcgcagcgcttccagcggcagcagcagcaccaggtctcgctccagc
tccagctccagctcgggctccagcaccagcacgggctccagcagcggctccagctcctcc
tcggcgtccagccgctccggcagctccagctcctcccgcagctccagctccagcagctcc
tctggctccccgagcccctcccggcgcaggcacgacaacagacggcgctcgcgctccaaa
tccaaaccccctaaaagagatgaaaaggagaggaaaagacggagcccgtcccctaaaccc
accaaagtgcacattgggaggctcaccaggaacgtgaccaaggaccacatcatggagata
ttttccacctatgggaagattaaaatgattgacatgcctgtggacaggatgcacccccac
ctgtccaaaggctacgcctatgtggagtttgagaacccggacgaggccgagaaggcactg
aagcacatggacggaggacagatcgatggccaggagatcaccgctactgctgtgctggcc
ccctggccccggccgccccctcggcggttcagtcctcccaggagaatgctcccaccgcct
cctatgtggcgccggtcacccccgcggatgcggagaaggtctcgctccccgaggcgcagg
tctcccgtgcgccggagatcccgctctcccggccgccgccgccacaggagccgctccagc
tccaactcctcccgataa

DBGET integrated database retrieval system