KEGG   Oryctolagus cuniculus (rabbit): 100347276
Entry
100347276         CDS       T03373                                 

Gene name
RSAD2
Definition
(RefSeq) radical S-adenosyl methionine domain containing 2
  KO
K15045  radical S-adenosyl methionine domain-containing protein 2
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu05160  Hepatitis C
ocu05164  Influenza A
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    100347276 (RSAD2)
   05160 Hepatitis C
    100347276 (RSAD2)
SSDB
Motif
Pfam: Radical_SAM Fer4_14 Fer4_12
Other DBs
NCBI-GeneID: 100347276
NCBI-ProteinID: XP_002721180
Ensembl: ENSOCUG00000012157
LinkDB
Position
Un
AA seq 363 aa
MWILESTASAGRLLSAFRWSLDSLYSNLASLLCWLRATLSFPAAWKAQKQQVREGPGETP
GQEEEEDSDVPTTPMSVNYHFTRQCNYRCGFCFHTAKTSFVLPLEEAKRGLLLLKEAGME
KINFSGGEPFIHDRGRYLGELVRFCKAELRLQSVSIVSNGSLIRERWFKDYGEYLDILAI
SCDSFDEQVNVLIGRGQGRKNHVDNLQKLRAWCRDYRVAFKINSVINRFNVQEDMNEQIK
ALNPVRWKVFQCLLIEGENSGADALREAARFVISDEEFEGFLERHKGVSCLVPESNQKMK
DSYLILDEYMRFLNCRNGRKDPSKSILDVGVREAIKFSGFDEKMFLKRGGKYVWSKADLK
LDW
NT seq 1092 nt   +upstreamnt  +downstreamnt
atgtggattctcgagagcactgcctccgcggggaggttgctgagtgcgttcaggtggtct
ctggactccctgtacagcaacttggcctcactcctgtgctggctgagggccaccctttcg
ttcccagctgcctggaaggcacagaagcaacaggttagagaaggacctggggagacccca
gggcaagaagaggaggaggacagcgatgtgcccaccacacccatgagcgtcaactaccac
ttcacccgccagtgcaactaccggtgcggcttctgcttccacacagccaagacgtccttt
gtgctgcccctcgaggaggccaagagagggctgcttctactcaaggaagcagggatggag
aagataaacttctcgggcggggagcccttcatccacgaccgcggcaggtacctgggcgag
ctggtgcggttctgcaaggcggagctgcggctgcagagtgtcagcatcgtgagcaacggg
agcctgattcgggagcgctggttcaaggactacggcgagtacttggacatcctcgccatc
tcctgcgacagctttgacgagcaggtcaacgtcctgatcggccgtggtcagggcaggaag
aaccacgtggacaatctgcagaagctgagggcgtggtgcagggattacagagtggctttc
aagatcaattctgtcatcaatcggttcaacgtgcaggaggacatgaacgagcagatcaaa
gcactcaaccccgtccgctggaaagtcttccagtgtctcctgattgagggtgagaattcc
ggagcagatgctttaagagaagccgcgagattcgtgattagcgatgaagaatttgaagga
ttcttagagcgtcacaagggcgtgtcctgtttggtgccggaatctaaccagaagatgaaa
gactcctaccttattctggatgaatacatgcgtttcctgaactgtaggaacgggcgcaag
gacccttccaagtccatcctggacgttggcgtgcgggaagctataaaattcagtggcttt
gacgagaagatgttcctgaagcgaggcggcaaatacgtgtggagcaaggccgacctgaag
ctggactggtag

DBGET integrated database retrieval system