KEGG   Oryctolagus cuniculus (rabbit): 100347292
Entry
100347292         CDS       T03373                                 

Gene name
PCF11
Definition
(RefSeq) PCF11 cleavage and polyadenylation factor subunit
  KO
K14400  pre-mRNA cleavage complex 2 protein Pcf11
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu03015  mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    100347292 (PCF11)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:ocu03021]
    100347292 (PCF11)
   03019 Messenger RNA biogenesis [BR:ocu03019]
    100347292 (PCF11)
Transcription machinery [BR:ocu03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     100347292 (PCF11)
Messenger RNA biogenesis [BR:ocu03019]
 Eukaryotic type
  mRNA processing factors
   3' end processing
    Pre-mRNA cleavage factor IIm (CFIIm)
     100347292 (PCF11)
SSDB
Motif
Pfam: CID SHOCT CFIA_Pcf11
Other DBs
NCBI-GeneID: 100347292
NCBI-ProteinID: XP_002708710
Ensembl: ENSOCUG00000004462
LinkDB
Position
1
AA seq 1553 aa
MSEQTPAEAGAAGAREDACRDYQSSLEDLTFNSKPHINMLTILAEENLPFAKEIVSLIEA
QTAKAPSSEKLPVMYLMDSIVKNVGREYLTAFTKNLVATFICVFEKVDENTRKSLFKLRS
TWDEIFPLKKLYALDVRVNSLDPAWPIKPLPPNVNTSSIHVNPKFLNKSPEEPSTPGTVV
SSPSISTPPIVPDIQKNLTQEQLIRQQLLAKQKQLLELQQKKLELELEQAKAQLAVSLSV
QQETSNLGPGSASTKLHVSQIPPMAVKVPHQVPVQPEKSRPGPSQIQDLKGTNRDPRLNR
MSQHSSHGKDQSHRKEFLMNTLNQSDIKTSKTVSLEKNSSKQEKSKSGEKITKKELDQLD
SKSKSKSKSPSPLKNKFSHTKDLKNQESESVRLSDMNKRDPRLKKHLQDKTDGKDDDGKD
KRKTAEKKDKDEHTKSSEHRLVGSRNKIINGIVQKQDAITDESEKQGTKPGRSSTRKRSR
SRSPKSRSPIIHSPKRRDRRSPKRRQRSMSPTSTPKAGKIRQSGVKQSHMEEFTPPSREE
RNAKRSTKQDVRDPRRMKKTEEERPQENVNQHSTKSGAEPKENIENWQSSKSTKRWKSGW
EENKSLQQGDEHSKSPHLRHRESWSSTKGILSPRAPKQQHRLSVDANLQIPKELTLASKR
ELLQKTSERLASGEITQDEFLVVVHQIRQLFQYQEGVREEQRSPFNDRFPLKRPRYEDSD
KPFVDSPASRFAGLDTNQRLTALAEDRPLFDGPSRPSVTRDGPTKMIFEGPNKLSPRIDG
PPTPGSLRFDGSPGQMGGGGPLRFEGPQGQLGGGCPLRFEGPPGPVGAPLRFEGPIGQAG
GGGFRFEGSPGLRFEGSAGGLRFEGPGGQPVGALRFEGHRGQPVGGIRFEGPHGQPVGGL
RFDSPRGQPVGGLRFEGGHGPAGAAIRFDGPHGQPGGGIRFEGPLLQQGVGLRFEGPHGQ
SVGGLRFEGQHNQLGGNLRFEGPHGQPGVGIRFEGPLVQQGGGMRFEGPSVPGGGLRIEG
PLGQGGPRFEGCHALRYDGQPGQPSLLPRIDGLHGQPGPRFERTPGQPGPQRFDGPPGQQ
IQPRFDGVPPRFDGPQHQQASRFDIPLGLQGARFDNHPSQRLESVSFNQTGPYNDPPGSA
FNAPSQGLQFQRHEQIFDSPQGPNFNGPHGPGNQNFSNPLNRPGHYFDEKNLQSSQFGNF
GNLPGPITVGNIQASQQVLTGVGQPVAFGQGQQFLPVHPQNPGAFVQNPSGALPKAYPDN
HLSQVDVNELFSKLLKTGILKLSQPDSATTQVNEVAAQPPPEEEEDQNEDQDVPDLTNFT
IEELKQRYDSVINRLYTGIQCYSCGMRFTTSQTDVYADHLDWHYRQNRTEKDVSRKVTHR
RWYYSLTDWIEFEEIADLEERAKSQFFEKVHEEVVLKTQEAAKEKEFQSVPAGPAGAVES
CEICQEQFEQYWDEEEEEWHLKNAIRVDGKIYHPSCYEDYQNTSSFDCTPSPSKTPVENP
LNIMLNIVKNELQEPCESPKVKEEQIDTPPACTEESIATPTEIKTENDTVESV
NT seq 4662 nt   +upstreamnt  +downstreamnt
atgtcagagcagacgccggccgaggccggtgctgcaggggcccgggaggacgcctgtcgg
gattatcagtcatcgctcgaagacctgaccttcaatagcaaaccgcacatcaatatgctg
accattctagccgaggagaacctgcccttcgccaaggagatcgtctctctcatcgaggcc
caaaccgccaaggctccttcctcagaaaagcttcctgttatgtaccttatggattctatc
gtgaaaaacgttggaagagagtatctcactgcctttactaaaaatctagttgcaacattt
atttgtgtgtttgaaaaggtggatgaaaatactagaaaaagtttatttaaattacgttcc
acatgggatgaaatattccctttgaagaaactttatgccctggatgtcagagttaattca
ttagatcctgcttggcctattaaacctctgccccccaatgtgaatacatctagcatccat
gtgaatcctaaatttttaaataaatcgccggaggaaccttcaacacctggcaccgtggtc
agctcccccagcatctctactcctccaattgttcctgatatacaaaagaatctcactcag
gagcaactaataagacagcagttactggcaaaacaaaaacagttgttagaacttcagcag
aaaaagctggagcttgagctagagcaagctaaggcacaattggcagtttctcttagtgtt
cagcaggagacatccaatttaggtcctggatctgcatcaaccaaattacatgtttcacaa
attccgcctatggcagtcaaagttccccatcaggttcctgtgcaacctgagaaaagccgt
ccaggtccatcccaaattcaggatttgaaaggcactaaccgggatccccgccttaacagg
atgagccaacattcctctcatgggaaagatcaaagtcacaggaaagaatttctaatgaac
acattgaaccagtctgatattaagacaagtaaaactgtatccttggagaaaaactcatcc
aagcaagaaaaaagtaaatcaggtgaaaaaataacaaagaaagaacttgaccaattagat
tctaaatccaaatctaaatctaaatcaccatcacctttgaaaaacaaattctcacataca
aaagacttgaaaaatcaagaatctgaaagtgtaaggttgtctgatatgaacaagagagat
ccaagattaaaaaaacatcttcaggataagactgatggcaaagatgatgatggaaaagat
aagagaaaaactgcagaaaaaaaggataaagatgagcacacaaaatcgtctgaacacagg
ctggttggaagtagaaataaaatcataaatggtattgtacaaaaacaggatgcaataaca
gatgaatcggaaaaacaggggacaaaaccagggagatctagtactagaaagcgatcaagg
tcaagatcccctaaatctcggtcaccaattatacattcaccaaagagaagagatagacgg
tcacccaaacgaaggcaaaggagtatgtctccaacttcaacacctaaagctggaaaaatt
cgccaatcaggagttaaacagtcacatatggaagagtttacgccaccttccagggaagaa
agaaatgctaagagaagtaccaaacaggatgttcgtgatccgaggcggatgaaaaagact
gaagaagaacgaccacaagaaaatgtaaatcagcattctacaaagtcaggcgctgaacca
aaagagaatatagaaaattggcaaagttccaagtctaccaaaagatggaaatctggttgg
gaagaaaataaaagcttgcaacagggtgatgaacatagtaaatctcctcatctaaggcat
agggagagctggtcaagcactaaagggatcttgtcacctcgagccccaaagcaacagcat
cgattaagtgtagatgctaatcttcagattcctaaagagttaactcttgcaagcaaaaga
gagttacttcaaaagacgagtgaacgtttagcatcgggtgaaattactcaggatgagttc
cttgttgttgtgcatcaaattcgacagctatttcagtatcaagaaggtgtacgagaagag
cagagatctccattcaatgatcgttttccacttaagcgacctagatatgaagattcagat
aaaccgtttgtagatagcccagcatcaagatttgcgggccttgatacaaatcagcgactt
acggccttggctgaagacagaccattatttgacggacctagtaggccatcagtaaccaga
gatggtccaaccaagatgatttttgaaggacctaataaattaagccctagaattgatgga
cctcctacaccaggttctcttcggtttgatgggtcaccaggacaaatggggggaggaggc
cctttgagatttgaaggtccacaaggtcagctaggaggtggatgtcctttgagatttgaa
ggtcctccaggaccagtaggggcacctctgaggtttgaggggccaattggtcaagcagga
ggtggtggttttaggtttgaaggttcgcctggtctgagatttgagggatccgcaggtggt
ttgcgatttgaaggaccaggaggccagcctgtgggtgctctcagatttgaggggcatcgt
ggtcaacctgtgggaggaataaggtttgagggacctcatggtcagcctgtgggtgggctt
agatttgatagtccccgaggtcagcctgtaggtggacttaggtttgaggggggtcatggt
ccagctggggctgccatcaggtttgatggacctcatggtcagccaggaggtgggatcaga
tttgagggccctttgctacagcaaggagttggattgaggtttgagggcccccatggtcag
tcagtgggtggtctgagatttgaaggacaacataatcaacttggtgggaaccttaggttt
gagggtccacatggtcaaccaggggttgggatcaggtttgaaggtcctttagttcaacaa
ggaggtggaatgaggtttgagggtccttctgtaccaggaggtggcctgagaattgaaggt
cctttgggtcaaggtggtccaagatttgaaggttgtcatgctttaaggtatgatggacag
ccaggtcagccatcactcttgccacgaattgatggattacatggtcagccgggtcctagg
tttgaaagaactcctggtcagccaggcccacagaggtttgatggaccacctggacagcag
atacaaccaagatttgatggtgtacctccaagatttgatggtccacaacaccagcaggca
tcaaggtttgatattcctcttggtcttcaaggcgcacgatttgacaatcatccttcacaa
aggcttgaatcagtgtctttcaatcagactggtccgtataatgatccaccgggcagtgct
tttaatgctccatcccaaggactgcagttccagagacatgaacaaatatttgattcacct
caaggaccaaattttaatggaccacatggccctggaaaccagaatttctcaaatcccctt
aacagacctggacactattttgatgaaaagaatcttcagagttctcagtttggaaacttt
ggcaatttacctggcccaataacagtaggaaatattcaggcctctcagcaggttctgact
ggtgttggtcagccagtagcatttggtcaaggacaacaatttttaccagttcatccacaa
aatcctggagcatttgttcagaatccctcaggagctcttcctaaggcatatcctgataat
catctcagtcaggtggatgtaaatgaattattttcaaaactgctaaaaacaggaattctc
aaattgtcccagcctgactcagctacaacacaagtaaatgaagtggctgctcagcctccc
cctgaagaggaggaagatcaaaatgaagatcaagatgttccagatctcactaattttact
attgaagagttgaaacaacgttatgacagtgttataaatcggctgtacactggtattcag
tgttattcttgtggaatgaggtttacaacatcacagacagatgtatatgcagatcacctg
gactggcattaccggcaaaatagaactgagaaggatgtgagcagaaaagtcactcataga
cgttggtactacagtttaacagactggatagaatttgaggaaatagctgatctagaagaa
cgtgcaaagagccagttttttgaaaaagtccatgaagaggttgtgctcaaaactcaggag
gctgctaaagaaaaggaatttcaaagtgtacctgctggaccagctggagcagttgagagc
tgtgaaatctgtcaagaacaatttgaacaatactgggatgaagaagaggaggaatggcac
ttaaaaaatgctattagagtagatggaaagatttatcatccatcatgttatgaagattat
caaaatacatcttcatttgattgtacaccatctcccagcaagacaccagttgaaaaccca
ttgaacattatgttgaacattgtcaaaaacgagttgcaggaaccctgtgaaagtcccaaa
gttaaggaagaacaaattgataccccaccagcttgtacagaggaaagcatagcaacaccc
actgaaattaaaacagaaaatgatacagtcgagtccgtttaa

DBGET integrated database retrieval system