KEGG   Oryctolagus cuniculus (rabbit): 100348492
Entry
100348492         CDS       T03373                                 

Gene name
RHEB
Definition
(RefSeq) Ras homolog enriched in brain
  KO
K07208  Ras homolog enriched in brain
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04072  Phospholipase D signaling pathway
ocu04140  Autophagy - animal
ocu04150  mTOR signaling pathway
ocu04151  PI3K-Akt signaling pathway
ocu04152  AMPK signaling pathway
ocu04211  Longevity regulating pathway
ocu04218  Cellular senescence
ocu04714  Thermogenesis
ocu04910  Insulin signaling pathway
ocu04919  Thyroid hormone signaling pathway
ocu05163  Human cytomegalovirus infection
ocu05165  Human papillomavirus infection
ocu05168  Herpes simplex virus 1 infection
ocu05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    100348492 (RHEB)
   04151 PI3K-Akt signaling pathway
    100348492 (RHEB)
   04152 AMPK signaling pathway
    100348492 (RHEB)
   04150 mTOR signaling pathway
    100348492 (RHEB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100348492 (RHEB)
  09143 Cell growth and death
   04218 Cellular senescence
    100348492 (RHEB)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100348492 (RHEB)
   04919 Thyroid hormone signaling pathway
    100348492 (RHEB)
  09149 Aging
   04211 Longevity regulating pathway
    100348492 (RHEB)
  09159 Environmental adaptation
   04714 Thermogenesis
    100348492 (RHEB)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    100348492 (RHEB)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    100348492 (RHEB)
   05163 Human cytomegalovirus infection
    100348492 (RHEB)
   05165 Human papillomavirus infection
    100348492 (RHEB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:ocu04031]
    100348492 (RHEB)
GTP-binding proteins [BR:ocu04031]
 Small (monomeric) G-proteins
  Ras Family
   Rheb
    100348492 (RHEB)
SSDB
Motif
Pfam: Ras Roc Arf MMR_HSR1 GTP_EFTU RsgA_GTPase SRPRB
Other DBs
NCBI-GeneID: 100348492
NCBI-ProteinID: XP_002715109
Ensembl: ENSOCUG00000013173
UniProt: G1T4W2
LinkDB
Position
13
AA seq 184 aa
MPQSKSRKIAILGYRSVGKSSLTIQFVEGQFVDSYDPTIENTFTKLITVNGQEYHLQLVD
TAGQDEYSIFPQTYSIDINGYILVYSVTSIKSFEVIKVIHGKLLDMVGKVQIPIMLVGNK
KDLHMERVISYEEGKALAESWNAAFLESSAKENQTAVDVFRRIILEAEKIDGAASQGKSS
CSVM
NT seq 555 nt   +upstreamnt  +downstreamnt
atgccgcagtccaagtcccggaagatcgcgatcctgggctaccggtctgtggggaaatcc
tcattgacgattcagtttgttgaaggtcaatttgttgactcctacgatccaaccatagaa
aacactttcacaaagttgatcacagtaaatggacaagaatatcatcttcaacttgtagac
acagctgggcaagatgaatattccatctttcctcagacatactccatagatattaatggt
tatattcttgtgtattctgttacatcaatcaaaagttttgaagtgattaaagttatccat
ggcaaattgttggacatggtggggaaagtgcaaatacctattatgctggttgggaataag
aaagacctgcatatggaaagggtgatcagttatgaagaagggaaagctttggcagaatct
tggaacgcagcttttttggagtcttctgctaaagaaaatcagactgctgttgatgttttc
agaaggataattttggaggcagaaaaaattgatggggcggcttcacaaggaaagtcttcg
tgctcggtgatgtga

DBGET integrated database retrieval system