KEGG   Oryctolagus cuniculus (rabbit): 100349007
Entry
100349007         CDS       T03373                                 

Gene name
IL12A
Definition
(RefSeq) interleukin 12A
  KO
K05406  interleukin 12A
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04620  Toll-like receptor signaling pathway
ocu04622  RIG-I-like receptor signaling pathway
ocu04625  C-type lectin receptor signaling pathway
ocu04630  JAK-STAT signaling pathway
ocu04658  Th1 and Th2 cell differentiation
ocu04940  Type I diabetes mellitus
ocu05133  Pertussis
ocu05134  Legionellosis
ocu05140  Leishmaniasis
ocu05142  Chagas disease
ocu05143  African trypanosomiasis
ocu05144  Malaria
ocu05145  Toxoplasmosis
ocu05146  Amoebiasis
ocu05152  Tuberculosis
ocu05162  Measles
ocu05164  Influenza A
ocu05168  Herpes simplex virus 1 infection
ocu05200  Pathways in cancer
ocu05321  Inflammatory bowel disease
ocu05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100349007 (IL12A)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100349007 (IL12A)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100349007 (IL12A)
   04622 RIG-I-like receptor signaling pathway
    100349007 (IL12A)
   04625 C-type lectin receptor signaling pathway
    100349007 (IL12A)
   04658 Th1 and Th2 cell differentiation
    100349007 (IL12A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100349007 (IL12A)
  09163 Immune disease
   05321 Inflammatory bowel disease
    100349007 (IL12A)
   05330 Allograft rejection
    100349007 (IL12A)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100349007 (IL12A)
  09171 Infectious disease: bacterial
   05133 Pertussis
    100349007 (IL12A)
   05134 Legionellosis
    100349007 (IL12A)
   05152 Tuberculosis
    100349007 (IL12A)
  09172 Infectious disease: viral
   05162 Measles
    100349007 (IL12A)
   05164 Influenza A
    100349007 (IL12A)
   05168 Herpes simplex virus 1 infection
    100349007 (IL12A)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100349007 (IL12A)
   05144 Malaria
    100349007 (IL12A)
   05145 Toxoplasmosis
    100349007 (IL12A)
   05140 Leishmaniasis
    100349007 (IL12A)
   05142 Chagas disease
    100349007 (IL12A)
   05143 African trypanosomiasis
    100349007 (IL12A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100349007 (IL12A)
   00536 Glycosaminoglycan binding proteins [BR:ocu00536]
    100349007 (IL12A)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Interleukins
   100349007 (IL12A)
Glycosaminoglycan binding proteins [BR:ocu00536]
 Heparan sulfate / Haparin
  Cytokines
   100349007 (IL12A)
SSDB
Motif
Pfam: IL12
Other DBs
NCBI-GeneID: 100349007
NCBI-ProteinID: XP_008264631
Ensembl: ENSOCUG00000010149
UniProt: A0A5F9CIX7
LinkDB
Position
14
AA seq 219 aa
MCSLRGLLLVSTLVLLNGLSLARNLPVATPDLGLFQCLNHSQNLLRAVSDTLHKARQTLE
FYSCTSEEIDHEDITKDKTSTVKACLPLELTKNESCLASRETSLIINGSCLSSGKTSSMV
TLCLSSIYEDLKMYQVEFMAMNAKLLMDSKRQIFLDQDMLGAIEELMQALNSNSGAVPQN
PSLEELDFYKTKIKLCILLHAFRIRVVTIDRMMSYLSSS
NT seq 660 nt   +upstreamnt  +downstreamnt
atgtgctccctgcgcggcctcctccttgtgtccacgcttgtccttctgaacggcctcagt
ctggccaggaacctgcccgtggccacaccggacctgggactattccagtgccttaaccac
tcccaaaacctgctgagagccgtcagcgacacgctacacaaggccagacaaactctagaa
ttctactcctgcacttctgaggagattgatcatgaagatatcacaaaagataagaccagc
acggtgaaggcctgtttaccactggagttaaccaagaatgagagttgcctggcttccaga
gagacctctttaataattaatgggagttgcctgtcttctggaaagacctcctctatggtg
accctgtgccttagtagtatctatgaggacttgaagatgtaccaggtagagttcatggcc
atgaatgcaaagcttctgatggattctaagagacagatctttctagatcaagacatgctg
ggagctattgaagagctgatgcaggccttgaattccaacagtggagctgtgccacaaaac
ccctcccttgaagagctggatttctataaaacaaaaatcaaactctgcattcttctgcat
gctttcagaattcgtgtggtgactattgatagaatgatgagctatctgagttcttcctga

KEGG   Oryctolagus cuniculus (rabbit): 100354852
Entry
100354852         CDS       T03373                                 

Gene name
IL12B
Definition
(RefSeq) interleukin 12B
  KO
K05425  interleukin 12B
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04620  Toll-like receptor signaling pathway
ocu04622  RIG-I-like receptor signaling pathway
ocu04625  C-type lectin receptor signaling pathway
ocu04630  JAK-STAT signaling pathway
ocu04658  Th1 and Th2 cell differentiation
ocu04940  Type I diabetes mellitus
ocu05133  Pertussis
ocu05134  Legionellosis
ocu05140  Leishmaniasis
ocu05142  Chagas disease
ocu05143  African trypanosomiasis
ocu05145  Toxoplasmosis
ocu05146  Amoebiasis
ocu05152  Tuberculosis
ocu05162  Measles
ocu05164  Influenza A
ocu05168  Herpes simplex virus 1 infection
ocu05200  Pathways in cancer
ocu05205  Proteoglycans in cancer
ocu05321  Inflammatory bowel disease
ocu05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100354852 (IL12B)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100354852 (IL12B)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100354852 (IL12B)
   04622 RIG-I-like receptor signaling pathway
    100354852 (IL12B)
   04625 C-type lectin receptor signaling pathway
    100354852 (IL12B)
   04658 Th1 and Th2 cell differentiation
    100354852 (IL12B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100354852 (IL12B)
   05205 Proteoglycans in cancer
    100354852 (IL12B)
  09163 Immune disease
   05321 Inflammatory bowel disease
    100354852 (IL12B)
   05330 Allograft rejection
    100354852 (IL12B)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100354852 (IL12B)
  09171 Infectious disease: bacterial
   05133 Pertussis
    100354852 (IL12B)
   05134 Legionellosis
    100354852 (IL12B)
   05152 Tuberculosis
    100354852 (IL12B)
  09172 Infectious disease: viral
   05162 Measles
    100354852 (IL12B)
   05164 Influenza A
    100354852 (IL12B)
   05168 Herpes simplex virus 1 infection
    100354852 (IL12B)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100354852 (IL12B)
   05145 Toxoplasmosis
    100354852 (IL12B)
   05140 Leishmaniasis
    100354852 (IL12B)
   05142 Chagas disease
    100354852 (IL12B)
   05143 African trypanosomiasis
    100354852 (IL12B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100354852 (IL12B)
   00536 Glycosaminoglycan binding proteins [BR:ocu00536]
    100354852 (IL12B)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Interleukins
   100354852 (IL12B)
Glycosaminoglycan binding proteins [BR:ocu00536]
 Heparan sulfate / Haparin
  Cytokines
   100354852 (IL12B)
SSDB
Motif
Pfam: IL12p40_C Ig_5 Ig_3 Ig_2 fn3 Ig_4 Tissue_fac ig I-set
Other DBs
NCBI-GeneID: 100354852
NCBI-ProteinID: XP_002710393
Ensembl: ENSOCUG00000016322
UniProt: G1TBD7
LinkDB
Position
3
AA seq 324 aa
MCHWQLVTFWFALVLLASPLVAIWELEKDVYVVELDWYPDAPGETVVLTCDTSEEDGITW
TSEQSNKVLGSGKTLTILVKEFGDAGQYTCHKGDKVLGHSKVLLHKKEDGIWSTDILKDQ
KEPKSKTFLKCEAKNYSGHFTCWWLTAISRDVKFSVKSNRGSSDPQGVTCGVPERVSVNH
TEYKYSVECQEDNACPAAEESLHLEVMLDAIHKLKYENYTSSFFIRDIIKPDPPQNLQMK
PLKNSRHVEVSWEYPDTWSTPHSYFSLTFCVQVQNKNKKEKKDRLCVDKTSATVMCHKDA
KIRVQARDRYYSSSWSEWAFVSCN
NT seq 975 nt   +upstreamnt  +downstreamnt
atgtgtcattggcagttggtcaccttctggtttgccctggtcttgctggcatctcccctc
gtggccatatgggaactggagaaagatgtttatgttgtagagttagattggtaccctgat
gccccaggagaaacagtggtcctcacctgcgacacctccgaagaagatggcattacctgg
acttcagaacagagcaataaggtcttaggatctggcaaaaccctgaccatcctagtcaaa
gagtttggagatgctggccaatacacctgccacaaaggagacaaggttctgggccattca
aaagtgttgcttcacaaaaaggaagatggaatttggtctactgatattttgaaggaccag
aaagaacctaaaagtaagacctttctaaaatgcgaggcaaagaattattctggacatttc
acctgttggtggctgacggcaatcagtagggacgtgaaattcagtgtcaaaagcaacaga
ggctcttctgacccccaaggagtgacatgtggagtaccagagagagtcagtgtgaaccac
acggagtataagtactcagtggagtgtcaggaagacaatgcctgtcctgctgctgaagag
agcctgcaccttgaggtgatgctggatgctattcacaagctcaaatatgaaaactacacc
agcagcttcttcatcagagacatcatcaaacctgatccaccccaaaacctgcagatgaag
ccattgaagaattcccggcatgtggaggtcagctgggagtaccctgatacctggagtacc
ccacactcatacttctccctgacattctgtgttcaggtgcagaacaagaacaagaaagaa
aagaaagatagactctgtgtggacaagacttcggccacagtcatgtgccacaaggatgcc
aagattcgtgtgcaagcccgggaccgctactatagctcatcttggagcgaatgggcattt
gtgtcctgcaattag

DBGET integrated database retrieval system