KEGG   Oryctolagus cuniculus (rabbit): 100353097
Entry
100353097         CDS       T03373                                 

Gene name
APPL1
Definition
(RefSeq) adaptor protein, phosphotyrosine interacting with PH domain and leucine zipper 1
  KO
K08733  DCC-interacting protein 13 alpha
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04211  Longevity regulating pathway
ocu05200  Pathways in cancer
ocu05210  Colorectal cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09150 Organismal Systems
  09149 Aging
   04211 Longevity regulating pathway
    100353097 (APPL1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100353097 (APPL1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100353097 (APPL1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100353097 (APPL1)
Membrane trafficking [BR:ocu04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    100353097 (APPL1)
SSDB
Motif
Pfam: BAR_3 PID PH BAR PH_9 Med26_C
Other DBs
NCBI-GeneID: 100353097
NCBI-ProteinID: XP_017199387
Ensembl: ENSOCUG00000006823
UniProt: G1SRT1
LinkDB
Position
9
AA seq 708 aa
MPGIDKLPIEETLEDSPQTRSLLGVFEEDATAISNYMNQLYQAMHRIYDAQNELSAATHL
TSKLLKEYEKQRFPLGGDDEVMSSTLQQFSKVIDELSSCHAVLSTQLADAMMFPITQFKE
RDLKEILTLKEVFQIASNDHDAAINRYSRLSKKRENDKVKYEVTEDVYTSRKKQHQTMMH
YFCALNTLQYKKKIALLEPLLGYMQAQISFFKMGSENLNEQLEEFLANIGTSVQNVRREM
DSDVETMQQTIEDLEVASDPLYVPDPDPTKFPVNRNLTRKAGYLNARNKTGLVSSTWDRQ
FYFTQGGNLMSQARGDVAGGLAMDIDNCSVMAVDCEDRRYCFQITSFDGKKSSILQAESK
KDHEEWICTINNISKQIYLTENPEEIAARVNQSALEAVTPSPSFQQRHESLRPAGQSRPP
TARTSSSGSLGSESTNLATLSLDSLVAPDTPIQFDIISPVCEDQPGQAKASGQGGRRTNP
FGESGGGTKSESEDSILHQLFIVRFLGSMEVKSDDHPDVVYETMRQILAARAIHNIFRMT
ESHLLVTCDCLKLIDPQTQVTRLTFPLPCVVLYATHQENKRLFGFVLRTSGGRSESNLSS
VCYIFESNNEGEKICDSVGLAKQIALHAELDRRASEKQKEIEKVKEKQQKELSKQKQIEK
DLEEQSRLIAASSRPNQASSEGQFVVLSSSQSEESDLGEETKKRESEA
NT seq 2127 nt   +upstreamnt  +downstreamnt
atgccggggatcgacaagctgcccattgaggagacgctggaggacagcccgcagacaagg
tcattactgggtgtatttgaagaagatgctacagctatttccaattacatgaaccaattg
tatcaagctatgcatcggatttatgatgcacagaatgaattaagcgcagcaacacacctg
acttcaaaacttttaaaagaatatgaaaaacagcggtttccgttgggaggtgatgatgaa
gttatgagctctactttacaacagttttcaaaagttatagatgagcttagctcttgtcat
gctgtactttcaactcaacttgctgatgccatgatgtttcccattacccaatttaaagaa
cgagatctgaaagagatactgacattaaaggaagtatttcagattgccagtaatgatcat
gatgctgcaattaacagatacagtcgattgtcaaaaaagagagaaaatgacaaggtgaag
tatgaagtaacagaagatgtgtacacttccagaaagaaacaacaccagaccatgatgcat
tatttttgtgcattaaatactcttcagtataagaagaaaatagcattgttagaacctcta
cttgggtacatgcaagctcagataagtttctttaagatgggttctgaaaatctcaatgaa
caactggaagaatttttagctaatattggaacgagtgtccagaatgttcgcagggaaatg
gacagtgacgtagagaccatgcagcagacaatagaggatttggaagtagccagtgacccc
ttatatgtgcctgacccagatcccaccaaatttcctgtgaatcgaaacttaacccgaaag
gctggataccttaatgctaggaataaaacaggcttggtgtcatctacctgggacagacag
ttttacttcacgcagggtggaaacttaatgagtcaagcccgtggggatgtggcaggaggt
ctggccatggacatagacaactgttcagtgatggctgtggactgtgaagacaggcggtac
tgttttcagatcacctcttttgatggaaaaaaatcttcaattttacaagcagaaagtaaa
aaagaccatgaagagtggatctgtacaataaacaacatatctaaacaaatatacttaact
gagaatccagaggaaattgctgcgcgagtcaatcagtctgctctagaagctgtcacccct
tcaccatctttccagcagcggcatgagagcctgcggccagcaggacaatctcgaccacca
acagctcggaccagcagttcgggatccttggggtccgagtccacaaatttggctacactc
tctctagattctcttgttgccccagacaccccaattcagtttgacataatttcccctgtg
tgtgaagatcagcctggccaggcaaaagcttctggccagggaggcaggcgtacaaatcca
tttggagaatctggaggaggtacaaaatctgaaagtgaagattctattcttcatcagtta
tttattgtccgattccttggttctatggaagtgaaatcagatgaccatccagatgttgtt
tatgaaacgatgcgccaaatcttagctgcccgagccatccataatatctttcgtatgaca
gaatcacatttattagtcacttgtgactgtttaaagttaattgatccacagacacaagtt
acaaggctgacgtttccattaccctgtgtagttttgtatgctacacaccaggaaaataag
cggctttttggatttgttcttcggacatcaggagggagaagtgaaagtaatctgtcatca
gtctgctatatttttgaatcaaacaatgagggggaaaagatttgtgattccgttggactg
gcaaaacaaatagctttgcatgctgaactggatcgcagggcatcagaaaaacagaaagaa
atagagaaggtgaaggagaagcagcagaaagaactcagtaaacaaaagcagattgagaag
gacttggaagaacagagtcgcttgatagctgcttccagtagaccaaaccaagccagtagt
gaggggcagtttgttgtccttagcagtagtcagtcagaagagagtgatttgggagaagaa
acaaagaagagagagtcagaagcataa

DBGET integrated database retrieval system