KEGG   Oryctolagus cuniculus (rabbit): 100353112
Entry
100353112         CDS       T03373                                 

Gene name
CXCL10
Definition
(RefSeq) C-X-C motif chemokine ligand 10
  KO
K12671  C-X-C motif chemokine 10
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04061  Viral protein interaction with cytokine and cytokine receptor
ocu04062  Chemokine signaling pathway
ocu04620  Toll-like receptor signaling pathway
ocu04622  RIG-I-like receptor signaling pathway
ocu04623  Cytosolic DNA-sensing pathway
ocu04657  IL-17 signaling pathway
ocu04668  TNF signaling pathway
ocu05160  Hepatitis C
ocu05164  Influenza A
ocu05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    100353112 (CXCL10)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100353112 (CXCL10)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100353112 (CXCL10)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100353112 (CXCL10)
   04622 RIG-I-like receptor signaling pathway
    100353112 (CXCL10)
   04623 Cytosolic DNA-sensing pathway
    100353112 (CXCL10)
   04657 IL-17 signaling pathway
    100353112 (CXCL10)
   04062 Chemokine signaling pathway
    100353112 (CXCL10)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    100353112 (CXCL10)
   05160 Hepatitis C
    100353112 (CXCL10)
   05169 Epstein-Barr virus infection
    100353112 (CXCL10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100353112 (CXCL10)
   00536 Glycosaminoglycan binding proteins [BR:ocu00536]
    100353112 (CXCL10)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Chemokines
   100353112 (CXCL10)
Glycosaminoglycan binding proteins [BR:ocu00536]
 Heparan sulfate / Haparin
  Chemokines
   100353112 (CXCL10)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 100353112
NCBI-ProteinID: XP_002717152
Ensembl: ENSOCUG00000016280
UniProt: G1TBA6
LinkDB
Position
15
AA seq 98 aa
MNQSAILIFCLIFLTLSGTKGMPLSRTVRCTCINISNKPVNPRSLEKLEIIPASQSCANV
EIIATMKKDGEKRCLNPELKAIKKLLKAFSKERSRGSS
NT seq 297 nt   +upstreamnt  +downstreamnt
atgaaccaaagtgcaattcttattttctgccttattttcctgactctgagtgggactaaa
ggaatgcctctctctagaactgtacgctgtacctgtatcaacattagtaataaacctgtt
aatccaagatccttggaaaaacttgaaatcattcctgcaagtcaatcttgtgcaaatgtt
gagatcattgccacaatgaaaaaggatggggagaagagatgtctgaatccagaattgaaa
gccatcaagaagttgctgaaagcatttagcaaggaaaggtccagaggatcatcgtaa

DBGET integrated database retrieval system