KEGG   Oryctolagus cuniculus (rabbit): 100354833
Entry
100354833         CDS       T03373                                 

Gene name
CPSF3
Definition
(RefSeq) cleavage and polyadenylation specific factor 3
  KO
K14403  cleavage and polyadenylation specificity factor subunit 3 [EC:3.1.27.-]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu03015  mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    100354833 (CPSF3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:ocu03021]
    100354833 (CPSF3)
   03019 Messenger RNA biogenesis [BR:ocu03019]
    100354833 (CPSF3)
Enzymes [BR:ocu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.27  Endoribonucleases producing 3'-phosphomonoesters
    3.1.27.-  
     100354833 (CPSF3)
Transcription machinery [BR:ocu03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     100354833 (CPSF3)
Messenger RNA biogenesis [BR:ocu03019]
 Eukaryotic type
  mRNA processing factors
   3' end processing
    Cleavage and polyadenylation specificity factor (CPSF) complex
     100354833 (CPSF3)
SSDB
Motif
Pfam: CPSF73-100_C Beta-Casp Lactamase_B Lactamase_B_6 RMMBL Lactamase_B_2 Lactamase_B_3 Beta_lactamase3
Other DBs
NCBI-GeneID: 100354833
NCBI-ProteinID: XP_002722528
Ensembl: ENSOCUG00000003728
UniProt: G1SKA3
LinkDB
Position
Un
AA seq 684 aa
MSAIPAEESDQLLIRPLGAGQEVGRSCIILEFKGRKIMLDCGIHPGLEGMDALPYIDLID
PAEIDLLLISHFHLDHCGALPWFLQKTSFKGRTFMTHATKAIYRWLLSDYVKVSNISADD
MLYTETDLEESMDKIETINFHEVKEVAGIKFWCYHAGHVLGAAMFMIEIAGVKLLYTGDF
SRQEDRHLMAAEIPNIKPDILIIESTYGTHIHEKREEREARFCNTVHDIVNRGGRGLIPV
FALGRAQELLLILDEYWQNHPELHDIPIYYASSLAKKCMAVYQTYVNAMNDKIRKQININ
NPFVFKHISNLKSMDHFDDIGPSVVMASPGMMQSGLSRELFESWCTDKRNGVIIAGYCVE
GTLAKHIMSEPEEITTMSGQKLPLKMSVDYISFSAHTDYQQTSEFIRALKPPHVILVHGE
QNEMARLKAALIREYEDNDEVHIEVHNPRNTEAVTLNFRGEKLAKVMGFLADKKPEQGQR
VSGILVKRNFNYHILSPCDLSNYTDLAMSTVKQTQAIPYTGPFNLLYYQLQKLTGDVEEI
EIQEKPALKVFKNITVIQEPGMVVLEWLANPSNDMYADTVTTVILEVQSNPKIRKGAVQK
VSKKLEMHVYSKRLEIMLQDIFGEDCVSVKDGALLSVTVDGRTANINLETRTVECEEGSE
DDESLREMVELAAQRLYEALTPVH
NT seq 2055 nt   +upstreamnt  +downstreamnt
atgtctgcgattcctgctgaggagagcgaccagctgctgatccgaccccttggagctggg
caggaagtaggaagatcatgtattattctggagttcaaaggaagaaaaataatgctggac
tgcgggatccaccctggcctggaaggaatggatgctcttccctacatcgacttaatagac
cccgctgagattgatctcctactaattagtcatttccatttggatcactgtggagctttg
ccctggtttctacagaagacaagtttcaaaggaagaacatttatgacgcatgcaacgaaa
gctatttacagatggcttctctcggattatgtgaaagttagtaacatatcagcagatgac
atgctgtatacagagacagacttggaagaaagcatggacaaaattgaaactatcaacttt
catgaagtgaaggaagtggcaggaatcaagttttggtgttaccacgcaggccacgtgctg
ggagccgccatgttcatgatcgagatcgcgggtgtgaagctcttgtacacaggtgacttc
tcaagacaagaagatagacacttaatggcagctgaaattcccaatattaaaccggatatt
cttatcattgaatcgacttacgggacccatatccacgagaagcgtgaagagcgagaagca
agattctgtaacactgtccacgacatcgtgaacagaggaggccgcggtctcattcccgtc
ttcgctctcgggagggctcaggagctcctcctgattctagatgagtactggcagaatcac
ccagagctgcatgacattcccatatactacgcctcatccctggccaagaagtgcatggcc
gtgtaccagacgtacgtcaacgccatgaacgacaagatccgcaaacagatcaacatcaac
aacccctttgtcttcaaacacatcagtaacctcaagagcatggaccactttgacgacatc
ggccccagcgtggtcatggcctcaccgggcatgatgcagagcggcctgtccagagagctc
tttgaaagctggtgcaccgacaagagaaacggcgtcatcatagcaggctactgcgtggaa
ggcacgcttgccaagcatatcatgtctgaacctgaagaaattactaccatgtctggacag
aagctaccattgaaaatgtctgttgattacatttctttctctgctcacacagattaccaa
caaaccagtgaatttattcgtgctttgaaaccgcctcatgtgattttggtccatggagag
cagaatgagatggccaggttgaaagcagccctgattcgagagtatgaggacaacgatgaa
gttcacatagaggtccataatcctcggaacacagaagcagtgaccttaaacttcagagga
gaaaagctagctaaggtcatgggctttttagcagacaaaaagccagaacaaggccagcgg
gtctcaggaatacttgttaaaagaaactttaactatcacatactgtctccgtgtgacctg
tccaattataccgacttggccatgagcactgtgaaacagacccaagctattccatacact
ggcccctttaatttgctctattaccagctacagaaattgacaggtgatgtagaagaaata
gaaattcaagaaaaacctgctctgaaagtgttcaaaaatattactgtaatacaggaacca
ggcatggtggtattagaatggttggcgaacccttctaacgacatgtatgcagacacggtg
acgacggtgatactggaagtccagtccaatcccaagataaggaaaggggcagtacagaag
gtttctaagaaattggaaatgcacgtttatagcaagaggttggagatcatgctgcaggac
atatttggagaagactgtgtcagtgtgaaagacggcgctctcctcagtgtcacggtggac
gggagaacggccaacatcaacttggagactcggacggtggagtgtgaagaggggagcgag
gacgacgagtcgctgcgggagatggtggagctggcggcgcagcggctgtacgaggcgctc
acgcccgtgcactga

DBGET integrated database retrieval system