KEGG   Oryctolagus cuniculus (rabbit): 100355883
Entry
100355883         CDS       T03373                                 

Gene name
TMPRSS11D
Definition
(RefSeq) transmembrane protease, serine 11D
  KO
K09641  transmembrane protease serine 11D [EC:3.4.21.-]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu05164  Influenza A
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    100355883 (TMPRSS11D)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ocu01002]
    100355883 (TMPRSS11D)
Enzymes [BR:ocu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     100355883 (TMPRSS11D)
Peptidases and inhibitors [BR:ocu01002]
 Serine peptidases
  Family S1: chymotrypsin family
   100355883 (TMPRSS11D)
SSDB
Motif
Pfam: Trypsin SEA Trypsin_2 DUF1986 DUF316
Other DBs
NCBI-GeneID: 100355883
NCBI-ProteinID: XP_017203015
Ensembl: ENSOCUG00000024745
UniProt: G1U5Y3
LinkDB
Position
15
AA seq 418 aa
MYRPARGSSTSRFLNPYVICFIVVAVVVILAVIVALLIHFLAFDKKSCFFHSSFQIRNVQ
YSDQLNSPATQEYRLLSERIESMISQTLQGSNLRNQFIRAHVVKLRQDSNGVIADVVMKF
RVSRNNNGDAMKRRVQDVLQQMLNNSGSLEINPSTTVTEITGQDTETIFTQQCGARPDLI
TLSEERIIGGTQAEEGDWPWQVSLQLNNAHHCGGILISNTWILTAAHCFRSYSDPRQWTA
TFGISTAVSRQRMRIRTILVHNNYRSATHENDIAAVQLEGAITFTRNIHSVCLPEATQNI
TPGSSAYVTGWGSLEYGGNTVTYLQQGRVRIISNEVCNAPASYNGAVLPTMVCAGLSQGG
VDACQGDSGGPLVQEDSRRLWFVVGIVSWGYQCGLPDKPGVYTRVTAYRDWIREQTGI
NT seq 1257 nt   +upstreamnt  +downstreamnt
atgtataggccagcacggggatcatcgacttcgagattcctgaatccatacgtgatttgc
ttcattgttgtagcagtcgtggtgatcctggcagtgatcgtagctctacttattcacttt
ttagcttttgataaaaaatcttgcttttttcacagcagctttcaaattcgaaatgttcaa
tatagcgatcagttaaattcaccagctacacaggaatacagattattgagtgaaagaatt
gaatctatgattagtcaaacactccaaggatcaaacttaagaaatcagttcattagagct
catgttgtcaaactgaggcaggatagtaatggtgtgatagcagatgttgtaatgaaattc
cgagtcagtagaaacaacaatggtgatgcaatgaaaagaagggttcaggatgttttacag
caaatgctgaataactctggaagcttggaaataaacccttcaactacggtaacagagatt
actggccaggatacagaaaccatcttcacccaacaatgtggggcccgtccagacctaata
acattgtctgaagagagaatcattggaggcacccaggctgaggagggagactggccctgg
caagtcagtctccagctcaacaacgctcaccactgtggaggcattttgatcagtaacacg
tggatcctgacagcagctcactgcttccggagctactctgatcctcgtcaatggactgcc
acctttggtatttccacagcagtttctagacagagaatgagaataaggacaattttagtc
cataacaattatagatctgcaacgcatgaaaatgatattgcagctgtgcaacttgaagga
gctatcacatttacaagaaacatccatagtgtgtgtctcccagaggccactcagaacatt
acacctggttcttcagcttatgtaacaggatgggggtctctagaatatggtggcaacacg
gttacctatctacagcaaggacgggtcagaataataagtaatgaagtatgtaacgcacca
gcgagttacaatggcgctgtcttgcctacaatggtgtgtgcaggattatctcaaggagga
gtggacgcatgccagggtgactctggtggcccactggtacaagaagactcgcgccggctt
tggttcgttgtgggcattgtaagctggggctatcagtgtggcctgcctgacaaaccagga
gtgtacacacgagtgacagcctaccgtgactggattagagaacaaaccgggatctag

DBGET integrated database retrieval system