KEGG   Oryctolagus cuniculus (rabbit): 100355991
Entry
100355991         CDS       T03373                                 

Gene name
BID
Definition
(RefSeq) BH3 interacting domain death agonist
  KO
K04726  BH3 interacting domain death agonist
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu01524  Platinum drug resistance
ocu04071  Sphingolipid signaling pathway
ocu04115  p53 signaling pathway
ocu04210  Apoptosis
ocu04215  Apoptosis - multiple species
ocu04217  Necroptosis
ocu04650  Natural killer cell mediated cytotoxicity
ocu04932  Non-alcoholic fatty liver disease
ocu05010  Alzheimer disease
ocu05014  Amyotrophic lateral sclerosis
ocu05022  Pathways of neurodegeneration - multiple diseases
ocu05152  Tuberculosis
ocu05160  Hepatitis C
ocu05161  Hepatitis B
ocu05162  Measles
ocu05163  Human cytomegalovirus infection
ocu05164  Influenza A
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05168  Herpes simplex virus 1 infection
ocu05169  Epstein-Barr virus infection
ocu05170  Human immunodeficiency virus 1 infection
ocu05200  Pathways in cancer
ocu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    100355991 (BID)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100355991 (BID)
   04215 Apoptosis - multiple species
    100355991 (BID)
   04217 Necroptosis
    100355991 (BID)
   04115 p53 signaling pathway
    100355991 (BID)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100355991 (BID)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100355991 (BID)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100355991 (BID)
   05014 Amyotrophic lateral sclerosis
    100355991 (BID)
   05022 Pathways of neurodegeneration - multiple diseases
    100355991 (BID)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100355991 (BID)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100355991 (BID)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100355991 (BID)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100355991 (BID)
   05162 Measles
    100355991 (BID)
   05164 Influenza A
    100355991 (BID)
   05161 Hepatitis B
    100355991 (BID)
   05160 Hepatitis C
    100355991 (BID)
   05168 Herpes simplex virus 1 infection
    100355991 (BID)
   05163 Human cytomegalovirus infection
    100355991 (BID)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100355991 (BID)
   05169 Epstein-Barr virus infection
    100355991 (BID)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100355991 (BID)
SSDB
Motif
Pfam: BID DUF1015 2H-phosphodiest
Other DBs
NCBI-GeneID: 100355991
NCBI-ProteinID: XP_008248350
Ensembl: ENSOCUG00000016266
UniProt: G1TB99
LinkDB
Position
Un
AA seq 210 aa
MDLHSAAYAVDPKVSSGPGPRDEHITNLLVLGFLQSCCSCSFHEELQVLGRELLSEAELA
DSYDCCSYDDDELQTDGNHASFLQMGRAEAGSESQEEVIRNIARRLAQIGDRMDHHIQPE
LLNNLVVEFVNDHSEEDRRRRLASAVEQAMETWPADMEREKATLMLTMLLAKKLAEHTPS
LLRAAFRAAVTLINQDLLAYVRNLAGNGME
NT seq 633 nt   +upstreamnt  +downstreamnt
atggatctgcatagtgctgcttatgccgtggatcccaaggtcagcagtggtccaggcccc
agggacgagcacatcacaaacctgctggtgttaggcttcctccagagctgctgcagctgc
agtttccatgaagaactacaggtgctgggtcgggagctgctctcagaagccgagctggcc
gacagctatgactgctgcagctacgatgatgacgaactgcagacggacggcaaccacgcc
agcttcctccagatggggagagcagaggcaggttcagagagccaagaagaggtcatcagg
aacattgccaggcgtctcgcccaaatcggggacaggatggaccaccacatccagccagag
ctgctgaacaacctggtggtggagtttgtgaatgaccactcggaggaggacagaaggagg
cggctggcatcggccgtggagcaagcgatggagacttggcctgcagacatggagagggag
aaggctacactgatgttgaccatgctgctggccaagaagctagccgagcatacgccgtcc
ttgctgcgcgctgccttccgtgcagcagtgaccctgattaaccaggacctgctcgcctac
gtgaggaacttagctggaaatggcatggagtga

DBGET integrated database retrieval system