KEGG   Oryctolagus cuniculus (rabbit): 100356548
Entry
100356548         CDS       T03373                                 

Gene name
CDH1
Definition
(RefSeq) cadherin 1
  KO
K05689  cadherin 1, type 1, E-cadherin
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04015  Rap1 signaling pathway
ocu04371  Apelin signaling pathway
ocu04390  Hippo signaling pathway
ocu04514  Cell adhesion molecules
ocu04520  Adherens junction
ocu05100  Bacterial invasion of epithelial cells
ocu05200  Pathways in cancer
ocu05213  Endometrial cancer
ocu05216  Thyroid cancer
ocu05218  Melanoma
ocu05219  Bladder cancer
ocu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100356548 (CDH1)
   04390 Hippo signaling pathway
    100356548 (CDH1)
   04371 Apelin signaling pathway
    100356548 (CDH1)
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100356548 (CDH1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    100356548 (CDH1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100356548 (CDH1)
  09162 Cancer: specific types
   05226 Gastric cancer
    100356548 (CDH1)
   05216 Thyroid cancer
    100356548 (CDH1)
   05218 Melanoma
    100356548 (CDH1)
   05219 Bladder cancer
    100356548 (CDH1)
   05213 Endometrial cancer
    100356548 (CDH1)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    100356548 (CDH1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ocu03036]
    100356548 (CDH1)
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:ocu04515]
    100356548 (CDH1)
   04090 CD molecules [BR:ocu04090]
    100356548 (CDH1)
Chromosome and associated proteins [BR:ocu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    100356548 (CDH1)
Cell adhesion molecules [BR:ocu04515]
 Cadherins
  Major cadherins
   100356548 (CDH1)
CD molecules [BR:ocu04090]
 Proteins
  100356548 (CDH1)
SSDB
Motif
Pfam: Cadherin Cadherin_C Cadherin_pro Cadherin_3
Other DBs
NCBI-GeneID: 100356548
NCBI-ProteinID: XP_002711685
Ensembl: ENSOCUG00000008805
UniProt: G1TYT3
LinkDB
Position
5
AA seq 884 aa
MGPPRRGSPALSLLLLLQVSSTLCQEPEPCHPGFGAESYRFTVPRRHLERGRVLGRVYFE
GCTGRPRTAYFSDDSRFQVGTDGVITVKRPLQLHRPETSFHVHAWDSSYRKLSTKVTLKA
VGPHRNHHHRHESSPGASTEVLTFPDSHHGLRRQKRDWVIPPISCPENEKGPFPKNLVQI
KSNRDKETQVFYSITGQGADTPPVGVFIIERETGWLKVTEPLDREHIAKYTLFSHAVSSN
GNAIEDPMEIVITVTDQNDNRPEFTQEVFKGSVMEGALPGTSVMQVTATDADDDVNTYNA
AIAYEILSQEPELPHKNMFRINPQTGVISVVTTGLDRETYPEYTLVVQAADLQGEGLSTT
AEAVITVTDINDNPPVFNPTTYVGQVPENEANYLVATLKVTDKDEPNTPAWEAVYTVLND
PEGQFIVTTDPATNDGILKTAKGLDFEAKQQYILHVTVQNAVPFEVALPTSTATVTVDVV
DRNEAPIFVPPEKRVEVPEDFGVGLEITSYTARDPDTFMQQKITYRIWRDAANWLEINPE
TGAISTRAELDREDTDYVKNSTYTALIIATDNGSPLATGTGTLLLILSDVNDNAPVPDPR
RMDFCQRDPQPQLINIIDPDLPPNTSPFTAELTHGASVNWTIEYSDPRQESIILKPKKTL
ELGDYKINLKLADNQNKDQVTTLDVLVCDCEGAVNNCMRATYVEAGLQVPAILGILGGIL
ALLILVLLLLLFVRRRGVVKEPLLPPEDDTRDNVYYYDEEGGGEEDQDFDLSQLHRGLDA
RPEVIRNDVAPTLMSVPQYRPRPANPDEIGNFIDENLKAADSDPTAPPYDSLLVFDYEGS
GSEAASLSSLNSSESDQDQDYDYLNEWGNRFKKLADMYGGGEDD
NT seq 2655 nt   +upstreamnt  +downstreamnt
atgggtcctccacgccgcggttctcccgcgctgtcgctgctgctgctgctgcaggtctcc
tcgacgctctgccaggagcccgagccctgccaccccggctttggcgccgagagctacagg
ttcaccgtgccccggcggcacttggagagaggccgagtcctgggcagagtgtacttcgaa
ggctgcacaggccgaccgaggacggcctacttctctgacgactctcgcttccaagtgggc
acggacggcgtgatcaccgtgaagcggcccctgcagctgcacaggccggaaaccagtttc
cacgtccacgcctgggactccagctacaggaagctctccaccaaggtcacgctgaaggcc
gtggggccgcaccgcaaccaccaccatcgccatgagtcttctcctggagccagcacggaa
gtgctcacgtttcccgactcccaccatggtctcagaagacagaagagggactgggttatt
cctcccatcagttgcccagaaaatgaaaaaggcccatttcctaaaaacctggtccagatc
aagtccaacagggacaaggagacccaggtcttctacagcatcaccggccagggagccgac
acgccgcctgttggtgtcttcatcatcgagagggagacgggatggctgaaggtgacggag
cctctggaccgagaacacatcgccaagtacacgctcttctctcacgccgtgtcgtctaac
gggaacgccattgaggacccgatggagatcgtgatcacggtgacggaccagaacgacaac
aggcctgagttcacccaggaggtcttcaagggctcggtcatggaaggcgcgctaccagga
acgtccgtgatgcaggtcacggctacggacgcggacgatgacgtgaacacctacaatgct
gccatcgcctacgaaatcctcagccaggagcccgagctgccgcacaagaacatgttcagg
atcaacccgcagaccggagtcatcagtgtggtcaccaccgggctggaccgagagacgtac
cccgagtacaccctggtcgttcaggctgctgacctccaaggcgagggcttgagcaccacg
gcggaagcggtgatcacggtcactgacatcaacgacaaccctcccgtcttcaaccccacc
acgtacgtgggccaggtgcccgagaacgaggccaactacctggttgccacgctcaaagtg
accgacaaagatgagcctaacaccccggcctgggaggctgtgtacaccgtattgaacgat
cctgagggccagttcattgtcaccacggacccggccaccaatgacggcatcctgaagaca
gccaagggcttggacttcgaggcgaagcagcagtacattctccacgtgaccgtgcagaac
gccgtccccttcgaggtggccctccccacctccacggccaccgtgactgtggacgtggtg
gacaggaacgaagcccccatctttgtgcctcccgagaagagggtggaggtgcccgaggac
ttcggcgtggggctagaaatcacatcctacaccgcccgggacccggacacattcatgcag
cagaagataacgtatcggatttggagggatgccgccaactggctggagattaacccagag
acgggtgccatctccacgcgggcggagctggaccgggaggacacagactatgtcaagaac
agcacgtacacggcgctcatcatcgccacggacaacggttccccacttgccaccggcact
ggaacccttctcctgatcctgtctgacgtgaatgacaacgcgccggtgcctgacccgcgc
aggatggacttctgccagagggacccacaacctcagctcataaacatcatcgatcccgac
cttcctcccaatacctcccccttcaccgcagagctcacgcacggggccagcgtcaactgg
accattgagtacagtgacccacgtcaagagtctatcattttgaagccaaagaagacttta
gagctgggcgactacaaaattaacctgaagctcgcagacaaccagaacaaagaccaggtg
accaccctggatgtgctcgtgtgtgactgcgagggcgccgtcaacaactgcatgcgggcc
acgtacgtggaagcgggcctgcaggtccccgccattctgggcattctcggaggaatcctg
gctctgctcatcctggttctgctgctgctgctgtttgtccggaggagaggggtggtcaaa
gagcccttactgcccccagaggacgacacccgggacaacgtgtattactacgacgaggaa
ggaggcggagaggaggaccaggactttgacttgagccagctgcacagaggcctggatgct
cggcccgaagtcattcgcaatgacgtggccccgaccctcatgagtgtgccccagtaccgt
ccccgacctgccaatcctgacgaaatcgggaacttcattgatgagaacctgaaggcggcc
gacagcgaccccacagcgcccccgtacgactccctgctggtgttcgactacgagggcagc
ggctccgaggctgccagcctcagctccctgaactcctcagagtccgaccaagaccaggac
tacgactacctgaacgagtggggcaaccgcttcaagaagctggcggacatgtacgggggc
ggcgaggacgactag

DBGET integrated database retrieval system