KEGG   Oryctolagus cuniculus (rabbit): 100356723
Entry
100356723         CDS       T03373                                 

Gene name
RBM8A
Definition
(RefSeq) RNA binding motif protein 8A
  KO
K12876  RNA-binding protein 8A
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu03013  RNA transport
ocu03015  mRNA surveillance pathway
ocu03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    100356723 (RBM8A)
  09122 Translation
   03013 RNA transport
    100356723 (RBM8A)
   03015 mRNA surveillance pathway
    100356723 (RBM8A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ocu03019]
    100356723 (RBM8A)
   03041 Spliceosome [BR:ocu03041]
    100356723 (RBM8A)
Messenger RNA biogenesis [BR:ocu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    EJC complex
     100356723 (RBM8A)
Spliceosome [BR:ocu03041]
 Complex C
  Other components
   EJC/TREX
    100356723 (RBM8A)
SSDB
Motif
Pfam: RRM_1 RRM_3 RRM_5
Other DBs
NCBI-GeneID: 100356723
NCBI-ProteinID: XP_002715691
Ensembl: ENSOCUG00000025693
UniProt: G1TX03
LinkDB
Position
13
AA seq 174 aa
MADVLDLHEAGGEDFAMDEDGDESIHKLKEKAKKRKGRGFGSEEGSRARMREDYDSVEQD
GDEPGPQRSVEGWILFVTGVHEEATEEDIHDKFAEYGEIKNIHLNLDRRTGYLKGYTLVE
YETYKEAQAAMEGLNGQDLMGQPISVDWCFVRGPPKGKRRGGRRRSRSPDRRRR
NT seq 525 nt   +upstreamnt  +downstreamnt
atggcggacgtgctggatcttcacgaggccgggggcgaggatttcgccatggatgaggat
ggggacgagagcatccacaaactgaaagaaaaagcaaagaagcgaaagggccgcggcttt
ggctcggaagaggggtcacgggcgcggatgcgggaggattacgacagtgtggagcaggat
ggcgatgaacccggaccacaacgctctgtcgaaggttggattctcttcgttactggagtc
cacgaggaagccactgaggaagacattcatgacaaattcgcagagtatggggaaataaaa
aatatccaccttaacctggacagacgtacaggatacctgaagggatatactctagttgag
tatgaaacatacaaggaggcccaggctgctatggaggggctcaatggccaggatttgatg
ggacagccgatcagcgtggactggtgttttgttcgaggtccacccaagggcaagaggaga
ggtggccgaagacgcagcaggagtccagaccggagacgacgttga

DBGET integrated database retrieval system