KEGG   Oryctolagus cuniculus (rabbit): 100356830Help
Entry
100356830         CDS       T03373                                 

Gene name
EIF3A
Definition
(RefSeq) eukaryotic translation initiation factor 3 subunit A
  KO
K03254  translation initiation factor 3 subunit A
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu03013  RNA transport
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    100356830 (EIF3A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:ocu03012]
    100356830 (EIF3A)
Translation factors [BR:ocu03012]
 Eukaryotic type
  Initiation factors
   eIF-3
    100356830 (EIF3A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PCI
Motif
Other DBs
NCBI-GeneID: 100356830
NCBI-ProteinID: XP_008268819
Ensembl: ENSOCUG00000004996
UniProt: G1SMZ5
LinkDB All DBs
Structure
PDB: 

Position
18
AA seq 1362 aa AA seqDB search
MPAYFQRPENALKRANEFLEVGKKQPALDVLYDVMKSKKHRTWQKIHEPIMLKYLELCVD
LRKSHLAKEGLYQYKNICQQVNIKSLEDVVRAYLKLAEEKTEAAKEESQQMVLDIEDLDN
IQTPESVLLSAVSGEDTQDRTDRLLLTPWVKFLWESYRQCLDLLRNNSRVERLYHDIAQQ
AFKFCLQYTRKAEFRKLCDNLRMHLSQIQRHHNQSTAINLNNPESQSMHLETRLVQLDSA
ISMELWQEAFKAVEDIHGLFSLSKKPPKPQLMANYYNKVSTVFWKSGNALFHASTLHRLY
HLSREMRKNLTQDEMQRMSTRVLLATLSIPITPERTDIARLLDMDGIIVEKQRRLATLLG
LQAPPTRIGLINDMVRFNVLQYVVPEVKDLYNWLEVEFNPLKLCERVTKVLNWVREQPEK
EPELQQYVPQLQSNTILRLLQQVAQIYQSIEFSRLTSLVPFVDAFQLERAIVDAARHCDL
QVRIDHTSRTLSFGSDLNYATREDAPIGPHLQSMPSEQIRNQLTAMSSVLAKALEVIKPA
HILQEKEEQHQLAVTAYLKNSRKEHQRILARRQTIEERKERLESLNIQREKEELEQREAE
LQKVRKAEEERLRQEAKEREKERILQEHEQIKKKTVRERLEQIKKTELGAKAFKDIDIED
LEELDPDFIMAKQVEQLEKEKKELQERLKNQEKKIDYFERAKRLEEIPLIKSAYEEQRIK
DMDLWEQQEEERITTMQLEREKALEHKNRMSRMLEDRDLFVMRLKAARQSVYEEKLKQFE
ERLAEERHNRLEERKRQRKEERRITYYREKEEEEQRRAEEQMLKEREERERAERAKREEE
LREYQERVKKLEEVERKKRQRELEIEERERRREEERRLGEDPLSRRDSRWGDRDSEGTWR
KGPEADSEWRRGPPEKEWRRGEGRDDERSHRRDEERPRRVGDDEDRESSLRPDDDRTLRR
GMEDDRGPRRGPDEERFSRRGLEDERPSWRSTDDDRPPRRIGEEDRGSWRHAEDDRPPRR
GLDDDRGSWRTADEDRGPRRMMDEDRGPRRGGADDERPSWRSADDDRGPRRGIDDDRGPR
RGLDDDRGPWRNADDDRIPRRGADDDRGPWRNMDDDRMSRRADDDRISRRGEDSRPGPWR
PFVKPGGWREKEKAREESWGPPRESRPPEEREWERERDRDNPDREENDKDPERERDRERD
GDREERFRRPRDEGGWRRGPAEEASSWRDSSRRDDRDRDDRRRERDDRRDLRDRRDLRDD
RDRRGPPLRSERDEVSSWRRADDRKDDRAEERDPPRRVPPPVLSRDRDRDRDRDRDRDRE
REREREREGEKEKTSWRAEKDRESLRRTKNETDEDGWTTVRR
NT seq 4089 nt NT seq  +upstreamnt  +downstreamnt
atgccggcctattttcagaggccggaaaatgctctgaaacgcgccaacgagtttcttgag
gttggcaaaaagcaacctgctttggacgttctttatgatgttatgaaaagtaagaaacac
agaacatggcaaaagatacacgagccaattatgttgaaatacttggaactttgcgtggac
cttcgcaagagccacttggctaaggaaggattataccagtataagaatatttgtcaacag
gtaaacattaaatctttagaggatgttgtcagggcatatttgaaactggcagaggaaaaa
actgaagctgctaaagaagaatctcagcagatggtgctggacatagaagatctggataat
attcaaactcctgagagtgttcttctgagtgccgtaagtggtgaagacactcaggatcgg
actgacagattacttttaactccttgggttaaattcctttgggaatcatacagacagtgt
ttggaccttcttcgcaacaattccagagttgagcgcctctaccatgatattgctcaacaa
gctttcaagttctgcctccagtatactcgtaaggctgaattccgtaagctttgtgacaat
ctgagaatgcacttatcgcaaattcagcgccaccataaccagagcacagctatcaatctt
aataatccagagagccagtccatgcacttggaaaccaggcttgttcagttggacagtgct
atcagcatggagttgtggcaagaagcattcaaagctgtggaggatattcacgggctgttc
tccttgtctaaaaaaccacctaaacctcagctgatggcaaattactataacaaagtctca
actgtgttttggaaatctggaaatgctctttttcatgcgtctacactccatcgtctttac
catctgtctagagaaatgaggaagaatcttacacaagatgagatgcaaagaatgtctacc
agagtccttctggccacgctttccatccccatcacccctgagcgcacggatatagctcga
cttctggatatggatggcatcatagttgaaaaacagcgtcgtctcgcaacactactgggt
cttcaagccccaccgacacgaattggccttattaatgatatggtgagattcaatgtccta
cagtatgttgttccagaagtgaaagatctttacaattggctggaagtggaatttaaccca
ctgaaactctgcgagagggtcacgaaggttctgaattgggtgcgggagcaacccgagaag
gagccagagctgcagcagtacgtgccgcagctgcagagcaacacgatcctccgcctcctg
cagcaggtggcgcagatttatcagagcattgagttctctcgtttgacttctctggttcct
tttgttgatgctttccaactggaacgggccatagtagatgcagcgaggcactgtgacctg
caggttcgtattgaccacacttctcgcactctgagctttggatctgatttgaattatgct
actcgagaagatgctccaatcgggcctcatctgcaaagcatgccttcagagcagataaga
aaccagctgacagccatgtcgtcagtgctggccaaggcacttgaagtcatcaaaccagct
catatactgcaagagaaagaggagcagcatcagctggctgttaccgcatatcttaaaaac
tcacgaaaagagcaccagcgcatcctggctcgccggcagacgattgaggagaggaaagag
cgccttgagagtctgaatattcagcgggagaaggaggagttggagcagagggaagctgaa
ctccaaaaagtccggaaagccgaagaagaaaggctgcgccaggaggcaaaggagagagag
aaggagcgaatcttacaggaacatgaacaaatcaaaaagaaaactgtccgtgagcgtttg
gaacagatcaagaagacagagctcggtgccaaagcgttcaaagatattgacattgaagat
ctggaagaactggatccagatttcatcatggctaaacaggttgaacagctggagaaggaa
aagaaggaacttcaagaacgcctaaagaatcaagaaaagaagatcgactactttgaaaga
gctaaacgtttggaagaaatcccgctgatcaagagtgcttatgaggaacagagaattaaa
gacatggatctgtgggaacaacaggaagaagaaaggattacaactatgcagctggagcga
gaaaaggctcttgaacacaagaatcgaatgtcacgaatgcttgaagacagagatctgttt
gtaatgcgactcaaagctgcccggcagtctgtttatgaggaaaaacttaaacagtttgaa
gagaggttagcagaagaaaggcacaatcgcctggaggaacgaaaaaggcagcgcaaagag
gaacgcagaataacttactacagagaaaaagaagaggaggagcagaggagggcagaagaa
cagatgctgaaagagcgagaagagagagaacgtgctgaacgagcgaaacgagaggaagaa
ctacgagaatatcaggagcgggtgaagaaattagaagaagtggaaaggaaaaaacgccag
agggaattggaaattgaagaaagagagcgtcgtcgagaggaagagaggcggcttggtgag
gacccgctgtctaggagggactcccgctggggggaccgagattccgaaggcacctggaga
aaagggcctgaagcagattccgagtggagaagaggcccccctgagaaggagtggcgacgt
ggagaagggcgggatgacgagcggtctcaccgaagggatgaagagcggccgaggcgtgtg
ggggacgatgaagacagagaatcttctcttaggccagatgatgaccggactctccggcgt
ggcatggaggacgacagaggcccccggcgtggtcccgatgaagagaggttctctcgccgt
gggctggaggacgagcggccttcctggcgcagtacagacgatgatcggcctcccaggcgg
attggtgaggaagacaggggaagctggcgccatgcagaggatgacaggccacctcgacga
ggactggatgacgacagaggaagctggcggacagccgatgaggacagaggcccaagacga
atgatggatgaggaccgggggccaaggcgagggggtgctgatgatgagcggccttcctgg
cggagtgctgatgatgaccggggtcccaggcggggcattgatgatgaccggggtcccagg
cgagggctagatgatgatcgaggaccttggaggaatgccgacgatgacaggattcccaga
cggggggctgacgatgacaggggtccttggagaaacatggatgacgaccggatgtcaaga
cgagctgatgatgaccggatttccaggcggggcgaggactccagacctggtccttggaga
ccgtttgttaagccaggtggatggagagagaaagaaaaagccagagaggagagttggggc
cctccccgagaatcgagaccacccgaagaacgtgaatgggagagagaaagagacagggac
aacccagaccgcgaggagaacgacaaggaccccgaaagagagagagacagggagagggac
ggggaccgagaggagcgcttcagaagacccagggacgaaggtggctggaggcgaggacca
gctgaggaagcctcaagctggagagattcgagtcgccgagatgatagggatagggacgac
cggcgccgtgaaagggacgaccggcgggacctgagagacagacgggatctgagggatgat
cgggaccggagaggacctcccttgaggtcagagcgtgatgaagtaagttcttggaggcgt
gctgatgacaggaaagatgaccgcgcagaggagcgggatcctcctcgtcgagttcctccc
ccagttctttctagagatcgagacagagaccgggaccgggaccgggaccgggaccgggaa
agggaaagagaaagagaaagagaaggtgaaaaagagaagacctcctggagagctgagaaa
gacagggaatctcttcgtcgtactaaaaatgagactgatgaagatggatggaccacggtg
cgacgctaa

DBGET integrated database retrieval system