KEGG   Oryctolagus cuniculus (rabbit): 100356995
Entry
100356995         CDS       T03373                                 

Gene name
RBBP5
Definition
(RefSeq) RB binding protein 5, histone lysine methyltransferase complex subunit
  KO
K14961  COMPASS component SWD1
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100356995 (RBBP5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ocu03036]
    100356995 (RBBP5)
Chromosome and associated proteins [BR:ocu03036]
 Eukaryotic type
  Histone modification proteins
   HMT complexes
    COMPASS/SET1 complex
     100356995 (RBBP5)
    COMPASS/SET1 complex (yeast)
     100356995 (RBBP5)
    MLL-HCF complex
     100356995 (RBBP5)
    MLL3/MLL4 complex
     100356995 (RBBP5)
SSDB
Motif
Pfam: WD40 ANAPC4_WD40 DUF2457
Other DBs
NCBI-GeneID: 100356995
NCBI-ProteinID: XP_002717493
Ensembl: ENSOCUG00000000095
UniProt: G1SCK8
LinkDB
Position
16
AA seq 538 aa
MNLELLESFGQNYPEEADGTLDCISMALTCTFNRWGTLLAVGCNDGRIVIWDFLTRGIAK
IISAHIHPVCSLCWSRDGHKLVSASTDNIVSQWDVLSGDCDQRFRFPSPILKVQYHPRDQ
NKVLVCPMKSAPVMLTLSDSKHVVLPVDDDSDLNVVASFDRRGEYIYTGNAKGKILVLKT
DSQDLVASFRVTTGTSNTTAIKSIEFARKGSCFLINTADRIIRVYDGREILTCGRDGEPE
PMQKLQDLVNRTPWKKCCFSGDGEYIVAGSARQHALYIWEKSIGNLVKILHGTRGELLLD
VAWHPVRPIIASISSGVVSIWAQNQVENWSAFAPDFKELDENVEYEERESEFDIEDEDKS
EPEQTGADAAEDEEVDVTSVDPIAAFCSSDEELEDSKALLYLPIAPEVEDPEENPYGPPP
DAVQTSLMDEGASSEKKRQSSADGSQPPKKKPKTTNIELQGVPNDEVHPLLGVKGDGKSK
KKQAGRPKGSKGKEKDSPFKPKLYKGDRGLPLEGSAKGKVQAELSQPLPAGGAISELL
NT seq 1617 nt   +upstreamnt  +downstreamnt
atgaacctcgagttgctcgagtcctttgggcagaactatccagaggaagctgatgggact
ttggattgtatcagcatggccctgacgtgcacctttaacaggtggggcacactgctcgca
gttggctgtaacgatggccgaattgtcatctgggatttcttgacgagaggcattgctaaa
ataattagtgcacacatccatccagtctgttccttatgctggagtcgagatgggcataag
cttgtcagtgcttccaccgataatatagtgtcacagtgggatgttctttcaggcgactgc
gaccagaggttccggtttccttcacccatcttaaaagtccagtatcatccacgagatcag
aacaaggttctcgtgtgtcccatgaaatctgctcctgtcatgttgaccctttcagattcc
aaacatgtcgttctgccggtagacgatgactccgatttgaacgtggtggcatcttttgat
aggcgaggagaatatatctatacaggaaatgcaaaaggcaagattttggtcttaaaaaca
gattctcaagatcttgttgcttccttcagagtaaccactggaacaagcaataccacagcc
ataaagtcaattgagtttgcccggaaggggagttgctttttaattaacacagcagatcga
ataatcagagtttatgatggcagagaaatcttaacctgcggaagagatggggagccggaa
cccatgcagaaactgcaggacttggtgaacaggaccccgtggaagaagtgttgtttctct
ggggatggggaatacatcgtggcgggctcggcccggcagcatgccctgtacatctgggag
aagagtatcggcaacctggtgaagattctccacgggacgcgaggagaacttctcctggat
gtggcttggcatcctgttcgacccatcatagcatccatttctagtggagtggtatctatc
tgggcacaaaatcaagtcgaaaattggagtgcatttgcaccagatttcaaagagttggat
gaaaatgtagagtacgaggaaagggaatcggagttcgatattgaagatgaagacaagagt
gaacctgaacagacaggggctgatgctgcggaagacgaggaagtggatgtcaccagtgtg
gaccccattgctgccttctgtagcagtgatgaagagctggaagattcaaaggctctgttg
tatttacccattgcccctgaggtagaagacccagaggaaaatccttatggccccccaccg
gatgcagtccaaacctccttgatggacgaaggggctagttcagagaagaagaggcagtct
tcagctgatgggtcccagcctcccaagaagaagcccaaaacaaccaacatcgaacttcaa
ggagtcccaaacgacgaagtccatccactactgggtgtgaagggggatggcaaatccaag
aagaagcaagcaggccggcctaaaggatcaaaaggtaaagagaaagattctccatttaaa
ccgaaactctacaaaggggacagaggtttacctctggaaggatcagcgaagggtaaagtg
caggcggagctcagccagcccttgccagcaggaggagcaatctcagaactattgtga

DBGET integrated database retrieval system