KEGG   Oryctolagus cuniculus (rabbit): 100357489
Entry
100357489         CDS       T03373                                 

Gene name
ATF6B
Definition
(RefSeq) activating transcription factor 6 beta
  KO
K09049  cyclic AMP-dependent transcription factor ATF-6 beta
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04022  cGMP-PKG signaling pathway
ocu04141  Protein processing in endoplasmic reticulum
ocu04151  PI3K-Akt signaling pathway
ocu04211  Longevity regulating pathway
ocu04261  Adrenergic signaling in cardiomyocytes
ocu04668  TNF signaling pathway
ocu04728  Dopaminergic synapse
ocu04911  Insulin secretion
ocu04915  Estrogen signaling pathway
ocu04918  Thyroid hormone synthesis
ocu04925  Aldosterone synthesis and secretion
ocu04926  Relaxin signaling pathway
ocu04927  Cortisol synthesis and secretion
ocu04928  Parathyroid hormone synthesis, secretion and action
ocu04934  Cushing syndrome
ocu04935  Growth hormone synthesis, secretion and action
ocu05020  Prion disease
ocu05030  Cocaine addiction
ocu05031  Amphetamine addiction
ocu05034  Alcoholism
ocu05161  Hepatitis B
ocu05163  Human cytomegalovirus infection
ocu05166  Human T-cell leukemia virus 1 infection
ocu05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100357489 (ATF6B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    100357489 (ATF6B)
   04022 cGMP-PKG signaling pathway
    100357489 (ATF6B)
   04151 PI3K-Akt signaling pathway
    100357489 (ATF6B)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100357489 (ATF6B)
   04915 Estrogen signaling pathway
    100357489 (ATF6B)
   04926 Relaxin signaling pathway
    100357489 (ATF6B)
   04935 Growth hormone synthesis, secretion and action
    100357489 (ATF6B)
   04918 Thyroid hormone synthesis
    100357489 (ATF6B)
   04928 Parathyroid hormone synthesis, secretion and action
    100357489 (ATF6B)
   04925 Aldosterone synthesis and secretion
    100357489 (ATF6B)
   04927 Cortisol synthesis and secretion
    100357489 (ATF6B)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100357489 (ATF6B)
  09156 Nervous system
   04728 Dopaminergic synapse
    100357489 (ATF6B)
  09149 Aging
   04211 Longevity regulating pathway
    100357489 (ATF6B)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100357489 (ATF6B)
  09164 Neurodegenerative disease
   05020 Prion disease
    100357489 (ATF6B)
  09165 Substance dependence
   05030 Cocaine addiction
    100357489 (ATF6B)
   05031 Amphetamine addiction
    100357489 (ATF6B)
   05034 Alcoholism
    100357489 (ATF6B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100357489 (ATF6B)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100357489 (ATF6B)
   05161 Hepatitis B
    100357489 (ATF6B)
   05163 Human cytomegalovirus infection
    100357489 (ATF6B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ocu03000]
    100357489 (ATF6B)
Transcription factors [BR:ocu03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    100357489 (ATF6B)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 ZapB bZIP_Maf DUF4407 GIT_CC YabA Docking
Other DBs
NCBI-GeneID: 100357489
NCBI-ProteinID: XP_002714342
Ensembl: ENSOCUG00000023089
LinkDB
Position
12
AA seq 698 aa
MAELMLLSEIADPTRFFTDNLLSPEDWGLRNSTLYAGLDEVADEPAQLFPCPEQDVPFDS
SSLDVGMDASPPEPPWDPLPIFPDLQVKSEPSSPCSSSSLNSESSHFSAVESLEAIGVGE
VLHVKTESLAPPLCLLGDDPAPPFEIVQINVGSTSDDPSDVQTKTEPVSPSSSVHSEASL
LSADTPHQAFLGEEVLEVKTESPSPPGCLVWDVPAPSFGAVQISMGPSSDGSSDRAPPPR
KPPLQPKPVVLTTVPMPPRAVPPSTAVLLQPLVQPPAVSPVVLIQGAIRVQPEGPVPPVP
RPERKSIVPAPMPGNSCPPEVDAKLLKRQQRMIKNRESACQSRRKKKEYLQGLEARLQAV
LADNQQLRRENAALRRRLEALLAENSELKLGSGNRKVVCIMVFLLFIAFNFGPVSINEPP
SAPAAPRMAREQPRPQRHLLEFSEQEPVQEVERTQGSSRGPEEPQASPAGQPSFRNLTAF
PGGTKELLLRDLDQLFLSSDCRHFNRTESLRLADELSGWVQRHQRGRRKTPQRAQERQKA
QPRKKSPPVRTIPTQPLGPPERNSEGQLQLYRRPDRSQPEFLDAIDRREDTFYVVSFRRD
HLLLPAISHNKTSRPKMSLVMPAMAPNETLSGRGASGDYEEMMQIECEVMDTRVIHIKTS
TVPPSLRKQPAQAPGNTTASAAGQARQASPPPLYLNHP
NT seq 2097 nt   +upstreamnt  +downstreamnt
atggcggagctaatgctcctcagcgagattgcggacccgacgcgtttcttcaccgacaac
ctgctgagcccggaggactggggtctgcggaacagcaccttgtacgccggcctggatgaa
gtggccgacgagccggcgcagctttttccttgcccagaacaggatgtcccgtttgacagc
agctctctggatgtggggatggatgccagcccacctgagcccccctgggaccctctgcct
atcttcccggatcttcaggtgaagtctgagccgtcctccccctgttcttcctcctctctc
aactcggagtcatcacacttctccgcagtggagtcgttagaagcgataggagtaggggag
gtgctgcacgtgaagacagaatccttggcgcccccgctgtgcctcctgggagatgatcca
gcacccccatttgagatcgtccagatcaatgtgggctccacttctgatgacccctcagac
gtccagaccaagacagaacctgtctctccctcttcctcggtgcactctgaggcctccctg
ctctcagcagacaccccgcaccaggctttcctaggagaggaggtgctggaggtgaagacg
gagtccccgtcgcctccgggatgcctggtctgggatgtgcccgcgccctcatttggagct
gtccagatcagcatgggcccatcctcggatggctcttcagacagagccccacccccccgg
aagccaccgctgcagcctaaacctgtggtgctaaccactgtcccgatgccaccccgagct
gtgcctcccagtaccgctgtcctcctgcagcccctcgtccagccacctgcagtgtcccca
gttgtcctcatccagggtgctatccgagtccagcctgaagggccagtcccccctgttcca
aggcctgagaggaagagcatcgtcccggctcccatgcctgggaactcctgcccgcctgaa
gtagacgcgaagctgctgaagcggcagcagcggatgatcaagaaccgggaatcggcctgc
cagtcccggaggaagaagaaggagtacctgcaggggctggaggcgcggctgcaggccgtg
ctggccgacaaccagcagctgcgccgggagaacgctgccctccgccggcggctggaggcc
ctgctggccgagaacagtgagctcaagctgggctccggaaaccggaaggtggtctgcatc
atggtcttccttctcttcattgccttcaactttggacctgtcagcatcaatgagcctcct
tcagcccccgccgctccgcggatggccagggagcagcctcggccccagagacacttgctg
gagttctcggagcaagagccagtgcaggaggttgagcgcacccaggggtcctcccgaggc
cccgaggagccccaggccagccctgcaggccagcccagtttcaggaacctgaccgccttc
cctgggggcaccaaggagctcctgctgagagacctggaccagctcttcctctcctccgac
tgccggcacttcaaccgcactgagtccctcaggcttgccgacgagctcagtggctgggtc
cagcgccaccagagaggccggcggaagacccctcagagggcccaggagagacagaaggct
cagccgcggaagaaatcgcctccagttaggacaatccccacccaacccctgggcccccca
gaaaggaactccgagggccagctgcagctctaccgccgccccgaccgctcgcagccagag
tttctggatgccatcgaccggcgggaagacaccttttatgttgtttccttccgaagggac
cacctgctgctgcccgccatcagccacaacaagacctcccggcctaagatgtccctggtg
atgcctgccatggcccccaacgagaccctgtcgggtcggggagcctccggggactatgaa
gagatgatgcagatcgagtgcgaggtcatggacaccagggtgattcacatcaagacctcc
acggtgcccccctcgctgcgcaagcagcctgcccaggccccaggcaacaccacggcgtcg
gcagccggccaggcccgacaggcctcccccccgcccctctacctcaatcacccctga

DBGET integrated database retrieval system