KEGG   Oryctolagus cuniculus (rabbit): 100358179
Entry
100358179         CDS       T03373                                 

Gene name
SFN
Definition
(RefSeq) stratifin
  KO
K06644  stratifin
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04110  Cell cycle
ocu04115  p53 signaling pathway
ocu04960  Aldosterone-regulated sodium reabsorption
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100358179 (SFN)
   04115 p53 signaling pathway
    100358179 (SFN)
 09150 Organismal Systems
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100358179 (SFN)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ocu04147]
    100358179 (SFN)
Exosome [BR:ocu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100358179 (SFN)
  Exosomal proteins of colorectal cancer cells
   100358179 (SFN)
  Exosomal proteins of bladder cancer cells
   100358179 (SFN)
SSDB
Motif
Pfam: 14-3-3 SIKE
Other DBs
NCBI-GeneID: 100358179
NCBI-ProteinID: XP_008264118
Ensembl: ENSOCUG00000006405
LinkDB
Position
13
AA seq 248 aa
MERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKNVVGGQRAAWR
VLSSIEQKSTEEGSEEKGPEVREYRERVEKELRGVCDAVLGLLDSHLIKEAGEAESRVFY
LKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMDISKKEMPPTNPIRLGLALNFSVFH
YEIANSPEEAITLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWTADNAGEEGG
EAPEEPQS
NT seq 747 nt   +upstreamnt  +downstreamnt
atggagagagccagtctgatccagaaggccaagctggccgagcaggctgagcgctacgag
gacatggcggccttcatgaagggcgcggtggagaagggcgaggagctctcctgtgaagag
cgaaacctgctctcggtggcctacaagaacgtggtgggcggccagagggcggcctggagg
gtcctgtccagcatcgagcagaagagcacggaggagggctcggaggagaagggcccggag
gtgcgcgagtaccgggagagggtggagaaggagctccgcggcgtgtgcgacgccgtgctg
gggctgctggactcccacctcatcaaggaggcaggcgaggccgagagccgcgtcttctac
ctcaagatgaagggcgactactaccgctacctggccgaggtggccaccggcgacgacaag
aagcgcatcatcgactcggcccgctccgcctaccaggaggccatggacatcagcaagaag
gagatgccgcccaccaaccccatccgcctgggcctggccctaaacttttctgtcttccac
tacgagatcgccaacagccccgaggaggccatcacgctggccaagaccactttcgacgag
gccatggccgacctgcacaccctcagcgaggactcctacaaggacagcaccctcatcatg
cagctgctgcgagacaacctgacgctctggacagccgacaacgccggcgaagagggcggg
gaggctcccgaggagccgcagagctga

DBGET integrated database retrieval system