KEGG   Oryctolagus cuniculus (rabbit): 100358381
Entry
100358381         CDS       T03373                                 

Gene name
CASC3
Definition
(RefSeq) cancer susceptibility candidate 3
  KO
K14323  protein CASC3
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu03013  RNA transport
ocu03015  mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    100358381 (CASC3)
   03015 mRNA surveillance pathway
    100358381 (CASC3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ocu03019]
    100358381 (CASC3)
Messenger RNA biogenesis [BR:ocu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    EJC complex
     100358381 (CASC3)
SSDB
Motif
Pfam: Btz
Other DBs
NCBI-GeneID: 100358381
NCBI-ProteinID: XP_002719398
Ensembl: ENSOCUG00000002954
UniProt: G1TNQ2
LinkDB
Position
19
AA seq 701 aa
MADRRRQRASQDTEDEESGASGSDSGGSPARGGGSCSGSAGGGGSGSLPSQRGGRAGALH
LWRVESGGAQSAEESECESEDGIEGDAVLSDYESAEDSEGEEEYSEEENSKVELKSEAND
AANSSAKEEKGEDKHDPKGTVTGERQSGDGQESTEPVENKMGKKGPKHLDDDEDRKNPAY
IPRKGLFFEHDLRGQTQEEEVRPKGRQRKLWKDEGRWEHDKFREDEQAPKSRQELIALYG
YDIRSAHNPDDIKPRRIRKPRFGSPPQRDPNWIGERPNKSHRHQGPGGTLPPRTFINRNA
AGTGRMSAPRNYSRSGGFKEGRAGFRPMEAGGQHGGRAGETATHETNYRSRRLEQTPVRD
PSPEADSPVLGGPEKEETASETPAAAPDTTPPAPDRPIEKKSYSRARRTRTKVGDAVKVA
EEVPPPPEGLTPAPAVPETTPPPPAKTGNWEAPVDSTSGLEQDVAQLNIAEQNWNPGQPS
FLQPRELRGMPNHIHMGAGPPPQFNRMEEMGVQGGRAKRYSSQRQRPVPEPPAPPVHISI
MEGHYYDPLQFQGPIYTHGDSPAPLPPQGMIVQPEMHLPHPGLHPHQTPAPLPNPGLYPP
PVSMSPGQPPPQQLLAPTYFSAPGVMNFGNPSYPYAPGALPPPPPPHLYSNTQAPSQVYG
GVTYYNPAQQQVQPKPSPPRRTPQPVTIKPPPPEVVSRGSS
NT seq 2106 nt   +upstreamnt  +downstreamnt
atggcggaccggcggcggcagcgcgcttcgcaggacacggaggacgaagaatctggcgct
tcgggctcagacagcggcggttccccggcgcggggcggcggcagctgcagcggcagcgct
ggaggcggcggcagcggctctctgccctcccagcgcggcggccgggccggggcccttcat
ctgtggcgggtggagagcgggggggcccagagcgccgaggagtcggagtgtgagagtgaa
gacggcatcgagggcgatgctgttctctcagattacgaaagtgcagaagactcagaaggt
gaagaggaatacagtgaagaggaaaactccaaagtggagctgaaatcagaagctaatgat
gctgccaattcttcagcaaaagaagagaagggggaagataagcatgaccccaaaggcact
gtgactggagagaggcaaagtggggatggacaggagagcacagagcctgtggagaataaa
atgggtaaaaagggccctaaacatttggatgatgatgaagatcgaaagaatccagcgtac
ataccccggaaagggctcttctttgagcatgaccttcgaggccaaacccaggaagaagaa
gtcagacccaaggggcgtcagcgaaagctatggaaggatgagggtcgttgggagcatgac
aagtttcgggaggatgagcaggccccgaagtcccgacaggagctcattgctctttatggc
tatgatatccgctcagctcacaatcctgatgacattaaaccccgaagaatccggaagccc
agatttggaagccctccacaaagagatccaaactggattggtgagcggccaaacaaatcc
catcgccaccagggacctgggggcaccctaccaccaaggacatttattaacaggaatgct
gcaggtactggccgcatgtctgcacccaggaattactctcgatctgggggcttcaaggaa
ggtcgtgctggttttaggcctatggaggccggcgggcagcatggaggccgggctggtgag
actgctacgcatgagactaattaccggtcacggcgcctggagcagactcctgtgagggat
ccatctcctgaagcagattctccagtgcttggtggccctgagaaggaggagacagcctca
gagacaccagctgcagctcctgacacgacaccaccagcccctgacagacccatcgagaag
aaatcctattcccgggcaagaagaacccgaaccaaagttggagatgcagtcaaagttgca
gaggaggtgccccctccccctgaagggctgaccccagctcctgcagttccagaaactacc
cctcctccacctgctaagactgggaactgggaggctcctgtggattctaccagtggactt
gaacaagatgtagcacaactaaatatagcagaacagaattggaatccagggcagccttcg
ttcctgcaaccacgggagcttcggggtatgcccaaccacatacacatgggagcaggacct
ccgcctcagtttaaccggatggaagaaatgggtgttcagggtggtcgagccaaacggtat
tcatctcagcggcaaagacctgttccagagcctcccgcccctcctgtgcatatcagtatc
atggagggacattactatgatccactgcagttccagggaccaatctatacccacggtgac
agccctgccccactgcctccgcagggcatgattgtgcagccagaaatgcatctcccccat
ccaggtttacatccccaccagacgccagcgcctctgcccaatccgggcctctatccccca
ccagtgtctatgtctcccggacagccaccacctcagcagttgcttgctcccacttacttt
tctgccccaggagtcatgaactttggtaatcccagttacccttacgctccaggggcactg
cccccaccaccacctcctcatctgtattctaacacacaggccccatcacaggtatatggg
ggagtgacctactataacccagcccagcaacaggtgcagccaaagccctccccaccacgg
aggactccccagccagtcaccatcaaaccccctccacctgaggttgtaagcaggggctcc
agttaa

DBGET integrated database retrieval system