KEGG   Oryctolagus cuniculus (rabbit): 100358771
Entry
100358771         CDS       T03373                                 

Gene name
TBK1
Definition
(RefSeq) TANK binding kinase 1
  KO
K05410  TANK-binding kinase 1 [EC:2.7.11.10]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04014  Ras signaling pathway
ocu04137  Mitophagy - animal
ocu04140  Autophagy - animal
ocu04620  Toll-like receptor signaling pathway
ocu04621  NOD-like receptor signaling pathway
ocu04622  RIG-I-like receptor signaling pathway
ocu04623  Cytosolic DNA-sensing pathway
ocu04657  IL-17 signaling pathway
ocu05014  Amyotrophic lateral sclerosis
ocu05022  Pathways of neurodegeneration - multiple diseases
ocu05135  Yersinia infection
ocu05160  Hepatitis C
ocu05161  Hepatitis B
ocu05162  Measles
ocu05163  Human cytomegalovirus infection
ocu05164  Influenza A
ocu05165  Human papillomavirus infection
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05168  Herpes simplex virus 1 infection
ocu05169  Epstein-Barr virus infection
ocu05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100358771 (TBK1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100358771 (TBK1)
   04137 Mitophagy - animal
    100358771 (TBK1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100358771 (TBK1)
   04621 NOD-like receptor signaling pathway
    100358771 (TBK1)
   04622 RIG-I-like receptor signaling pathway
    100358771 (TBK1)
   04623 Cytosolic DNA-sensing pathway
    100358771 (TBK1)
   04657 IL-17 signaling pathway
    100358771 (TBK1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    100358771 (TBK1)
   05022 Pathways of neurodegeneration - multiple diseases
    100358771 (TBK1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100358771 (TBK1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100358771 (TBK1)
   05162 Measles
    100358771 (TBK1)
   05164 Influenza A
    100358771 (TBK1)
   05161 Hepatitis B
    100358771 (TBK1)
   05160 Hepatitis C
    100358771 (TBK1)
   05168 Herpes simplex virus 1 infection
    100358771 (TBK1)
   05163 Human cytomegalovirus infection
    100358771 (TBK1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100358771 (TBK1)
   05169 Epstein-Barr virus infection
    100358771 (TBK1)
   05165 Human papillomavirus infection
    100358771 (TBK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ocu01001]
    100358771 (TBK1)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100358771 (TBK1)
Enzymes [BR:ocu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.10  IkappaB kinase
     100358771 (TBK1)
Protein kinases [BR:ocu01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   100358771 (TBK1)
Membrane trafficking [BR:ocu04131]
 Autophagy
  Xenophagy
   Other xenophagy associated proteins
    100358771 (TBK1)
SSDB
Motif
Pfam: TBK1_CCD1 Pkinase TBK1_ULD PK_Tyr_Ser-Thr Pkinase_fungal DUF713 Kinase-like CEP63 ubiquitin
Other DBs
NCBI-GeneID: 100358771
NCBI-ProteinID: XP_002711357
Ensembl: ENSOCUG00000012136
UniProt: A0A5F9CBX9
LinkDB
Position
4
AA seq 761 aa
MQVPCDSSLTWSVGLLSSPVPSVTRESPDQAEMQSTSNHLWLLSDILGQGATANVFRGRH
KKTGDLFAIKVFNNISFLRPVDVQMREFEVLKKLNHKNIVKLFAIEEETTTRHKVLIMEF
CPCGSLYTVLEEPSNAYGLPESEFLIVLRDVVGGMNHLRENGIVHRDIKPGNIMRVIGED
GQSVYKLTDFGAARELEDDEQFVSLYGTEEYLHPDMYERAVLRKDHQKKYGATVDLWSIG
VTFYHAATGSLPFRPFEGPRRNKEVMYKIITGKPSGAISGVQKAENGPIDWSADMPVSCS
LSRGLQVLLTPVLANILEADQEKCWGFDQFFAETSDILHRMIIHVFSLQQMTAHKIYIHS
YNTATVFHELVYKQTKIISSNQELIYEGRRLVLEPGRLAQHFPKTTEENPIFVVSREPLS
TIGLIYEKISLPKVHPRYDLDGDASMAKTITGVVCYACRIAGTLLLYQELMRKGIRWLIE
LVKDDYNEAVHKKTEVVITLDFCIRNIEKTVKVYEKLMKINLEAAELGEISDIHTKLLRL
SSSQGTIETSLQDVDSRLSPGGLLADAWAHQEGTHPKDRNVEKLQVLLNCITEIYYQFKK
DKAERRLAYNEEQIHKFDKQKLYYHATKAMTHFSDECVKKYEAFLDKSEEWMRKMLHLRK
QLLSLTNQCFDIEEEVSKYQDYTNELQETLPQKMFAASSGIKHTMTPVYPSSNTLVEMTL
GMKKLKEEMEGVVKELAENNHILERFGSLTMDGGLRNVDCL
NT seq 2286 nt   +upstreamnt  +downstreamnt
atgcaggttccctgtgactcctcgctgacatggagtgtgggtttgttatccagccccgtt
cccagtgtaacaagagaatcacctgaccaagccgagatgcagagcacttctaatcatctg
tggctcttatctgatattttaggccaaggagcaactgcaaatgtctttcgtggaagacat
aagaaaactggtgatttatttgctatcaaagtatttaataacataagctttcttcgccca
gtggatgttcagatgcgagaatttgaagtgttaaaaaagctcaatcacaaaaatatcgtc
aaattatttgctattgaagaggagacaacaacaagacataaagtgcttattatggagttt
tgtccctgtgggagtttatatactgttttagaagagccatctaatgcctatggactacca
gaatctgaatttttaattgttttgcgagatgtggtgggtggaatgaatcatctccgagag
aatggcatcgtgcaccgtgatatcaaaccaggaaatatcatgcgagttataggggaggat
ggacagtcggtatacaaactcacagattttggtgcagctagagaattagaagatgatgag
cagtttgtttctctgtatggcacagaagaatatttgcatcctgatatgtatgagagagca
gtgctaagaaaagatcaccagaagaaatatggagcaaccgttgacctttggagcattggg
gttacattttaccatgcagctacaggatcactgccatttagaccttttgaagggcctcgt
aggaataaagaagtgatgtataaaataattactgggaagccttctggtgcaatatctgga
gtacagaaagcagaaaacggaccaatcgactggagcgcagacatgcctgtttcttgtagt
ctttctcggggtcttcaggttctacttacccctgttcttgcaaacatccttgaagcagat
caggaaaagtgttggggttttgaccagttttttgcagaaactagtgatatactccacaga
atgataattcatgtcttctcactacaacaaatgacagctcataaaatttatattcatagc
tataatactgctactgtatttcatgaactggtatataaacaaaccaaaattatttcttca
aatcaagaacttatctatgaaggacgacgcttagtcctcgaacctggaagactggcacag
catttccctaaaactaccgaggaaaatcccatttttgtagtaagccgggaaccactgagt
accatagggttaatatatgaaaaaatttccctccctaaagtacatccacgttatgattta
gacggggatgctagcatggctaagacaatcacaggagttgtgtgttatgcctgtagaatt
gctggtaccttgctgctttatcaggaattaatgcgaaagggaatccgatggttgattgaa
ttagttaaagatgattacaatgaagctgttcacaaaaagacagaagttgtgatcacattg
gatttctgcatcagaaacattgaaaaaactgtgaaagtatatgaaaagttgatgaagatc
aatctagaagcagcagagttaggtgaaatttcagacattcacacaaaattgttgagactt
tccagttctcagggaacaatagaaaccagtcttcaggatgtggacagcaggttatctcca
ggtggattgctggcagatgcatgggcacatcaagaaggcacacatccaaaagacagaaat
gtagaaaaactacaggtcctgttaaattgcatcacagagatttactaccagttcaaaaaa
gacaaagcagaacgaagactagcttataacgaagaacaaatccacaaatttgataagcaa
aaattatattaccatgcaacaaaagctatgacccacttttcagatgaatgtgttaaaaag
tacgaagcatttttggataagtcagaagagtggatgagaaagatgcttcatcttaggaaa
cagttgttatctctaactaaccagtgtttcgatattgaagaagaagtatcaaagtatcaa
gactatactaatgagttacaagaaactctgcctcagaaaatgtttgcagcctccagtgga
atcaaacataccatgaccccagtttatccaagttctaacacattagtggaaatgactctt
ggtatgaagaaattaaaggaagaaatggaaggagtggttaaagaacttgctgaaaataat
catattttggaaagatttggctctttaaccatggatggtggccttcgcaatgttgactgt
ctttag

DBGET integrated database retrieval system