KEGG   Oryctolagus cuniculus (rabbit): 100358839
Entry
100358839         CDS       T03373                                 

Gene name
UPK3A
Definition
(RefSeq) uroplakin 3A
  KO
K19520  uroplakin-3a
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu05219  Bladder cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09160 Human Diseases
  09162 Cancer: specific types
   05219 Bladder cancer
    100358839 (UPK3A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ocu04147]
    100358839 (UPK3A)
Exosome [BR:ocu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100358839 (UPK3A)
SSDB
Motif
Pfam: PTP_tm
Other DBs
NCBI-GeneID: 100358839
NCBI-ProteinID: XP_002723521
Ensembl: ENSOCUG00000017064
UniProt: G1TCX9
LinkDB
Position
Un
AA seq 287 aa
MPLLWALLALGCLRFGSAVNLQPQLASVTFATNNPTLTTVALEKPLCVFDSSGALNGTYE
VYLYVLEDSAGSRNASVQDSTNAPLDSTFQQTQGGRTGPYRAVAFDLTPCSDLPNLDAVG
DVTQASEILNAYLVKVGGNGSCLWDPNFQGLCNAPLSAATQYRFKYILVNTATGLVQDQT
LWSDAIRTNRPAPYAAIDTWPGRRSGGMIVITSILGSLPFFLLLGFAGAVVLSFLDMGTA
DGEMTHDSQILQEAAPRSLGSSELSYASVNRGPPLDRAEAYSGKLQD
NT seq 864 nt   +upstreamnt  +downstreamnt
atgcctctgctctgggccctgctggccctcggctgcctgcggttcggctcggcggtgaac
ctccagcctcaactggccagcgtgactttcgccaccaacaaccccaccctcaccaccgtg
gccttggaaaagccgctctgcgtgtttgacagctcgggggccctcaacggcacctacgaa
gtctacctctacgtcctggaggactcggccggctccaggaatgcctccgtgcaggacagc
accaacgcccccctggactcgaccttccagcagacccagggtgggaggacaggcccctac
agggctgtggcctttgacctgaccccctgcagcgacctgcccaacctggatgctgtcggg
gacgtgacccaggcctcggagatcctgaacgcatacctggtgaaggtgggcggcaatggg
agctgcctgtgggaccctaacttccagggcctctgcaacgctcccctgtcggcagccaca
cagtacaggttcaagtacatcctggtcaacacggccacaggcttggtccaggaccagact
ctgtggtcagatgccatccgcaccaaccggcctgccccctacgcggccatcgacacgtgg
ccgggccggcgcagcgggggcatgatcgtcatcacctccatcctgggctccctgcccttc
ttcctgctgctgggcttcgctggagccgtcgtcctcagcttcctggacatgggcaccgcg
gacggggaaatgacgcacgactcccagatcctgcaggaggctgcccccaggtccctgggc
agctcggagctgtcctacgcgtctgtgaaccgggggccgcccctggacagggccgaggcg
tactccggcaagctgcaggactga

DBGET integrated database retrieval system