KEGG   Oryctolagus cuniculus (rabbit): 100359017
Entry
100359017         CDS       T03373                                 

Gene name
RAE1
Definition
(RefSeq) ribonucleic acid export 1
  KO
K14298  mRNA export factor
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu03013  RNA transport
ocu05014  Amyotrophic lateral sclerosis
ocu05164  Influenza A
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    100359017 (RAE1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    100359017 (RAE1)
  09172 Infectious disease: viral
   05164 Influenza A
    100359017 (RAE1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ocu03019]
    100359017 (RAE1)
   03036 Chromosome and associated proteins [BR:ocu03036]
    100359017 (RAE1)
Messenger RNA biogenesis [BR:ocu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     100359017 (RAE1)
Chromosome and associated proteins [BR:ocu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    100359017 (RAE1)
SSDB
Motif
Pfam: WD40 ANAPC4_WD40 Nup160 Exonuc_X-T_C
Other DBs
NCBI-GeneID: 100359017
NCBI-ProteinID: XP_008251273
Ensembl: ENSOCUG00000001585
UniProt: G1SFQ1
LinkDB
Position
Un
AA seq 380 aa
MKTRRGCDRRGKMSLFGTTSGFGTSGTSMFGSTTTDNHNPMKDIEVTSSPDDSVGCLSFS
PPTLPGNFLIAGSWANDVRCWEVQDSGQTIPKAQQMHTGPVLDVCWSDDGSKVFTASCDK
TAKMWDLNSNQAIQIAQHDAPVKTIHWIKAPNYSCVMTGSWDKTLKFWDTRSSNPMMVLQ
LPERCYCADVIYPMAVVATAERGLIVYQLENQPSEFRRIESPLKHQHRCVAIFKDKQNKP
TGFALGSIEGRVAIHYINPPNPAKDNFTFKCHRSNGTNTSAPQDIYAVNGIAFHPVHGTL
ATVGSDGRFSFWDKDARTKLKTSEQLDQPIAACGFNHNGNIFAYASSYDWSKGHEFYNPQ
KKNYIFLRNAAEELKPRNKK
NT seq 1143 nt   +upstreamnt  +downstreamnt
atgaagacgaggaggggctgcgaccgcaggggcaagatgagtctgtttggaaccacctcg
ggctttgggaccagcgggaccagcatgttcggcagcacgacgaccgataaccacaacccc
atgaaggacatcgaggtgacgtcttctcccgacgacagcgtgggctgcctgtccttcagc
ccgccgaccttgccggggaacttcctcatcgcggggtcgtgggccaatgacgtccgctgc
tgggaggttcaggacagcgggcagaccatcccgaaagcccagcagatgcacaccgggccg
gtcctcgacgtctgctggagtgacgacgggagcaaagtgttcaccgcatcttgtgataaa
actgccaaaatgtgggacctcaacagcaatcaggcaattcagatcgcacagcacgatgct
cctgttaaaaccatacactggatcaaagcccccaactacagctgcgtgatgaccgggagc
tgggacaagaccctgaagttctgggatacgcggtcgtcaaaccctatgatggttctgcag
ctccccgagaggtgttactgtgcggacgtgatctacccgatggccgtggtggcgaccgcg
gagaggggcctgattgtgtaccagctggagaaccagccttccgagttccggaggatagag
tccccgctgaaacaccagcatcgatgtgtggctatttttaaagacaaacagaacaagcca
actggatttgctctgggcagtattgaggggcgagttgctattcactacatcaaccctccg
aatcctgccaaagacaacttcacctttaagtgtcatcgctccaacgggaccaacacgtca
gcgcctcaggacatctacgcggtcaatggcatcgcgttccatcccgttcacggcaccctg
gccaccgtggggtctgacggccgcttcagcttctgggacaaggatgccagaacaaaactc
aaaacttcagagcagttagaccagccgatagcagcctgcggcttcaaccacaacggcaac
atcttcgcctacgcctccagctacgactggtccaagggacatgagttctataatccccag
aagaaaaattacatcttcctgcgcaacgcggctgaagagctgaagcccaggaataagaag
tag

DBGET integrated database retrieval system