KEGG   Oryctolagus cuniculus (rabbit): 100359062
Entry
100359062         CDS       T03373                                 

Gene name
ATR
Definition
(RefSeq) ATR serine/threonine kinase
  KO
K06640  serine/threonine-protein kinase ATR [EC:2.7.11.1]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu03460  Fanconi anemia pathway
ocu04110  Cell cycle
ocu04115  p53 signaling pathway
ocu04218  Cellular senescence
ocu05165  Human papillomavirus infection
ocu05166  Human T-cell leukemia virus 1 infection
ocu05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    100359062 (ATR)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100359062 (ATR)
   04115 p53 signaling pathway
    100359062 (ATR)
   04218 Cellular senescence
    100359062 (ATR)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100359062 (ATR)
   05170 Human immunodeficiency virus 1 infection
    100359062 (ATR)
   05165 Human papillomavirus infection
    100359062 (ATR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ocu01001]
    100359062 (ATR)
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ocu03400]
    100359062 (ATR)
Enzymes [BR:ocu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100359062 (ATR)
Protein kinases [BR:ocu01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   100359062 (ATR)
DNA repair and recombination proteins [BR:ocu03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    100359062 (ATR)
SSDB
Motif
Pfam: PI3_PI4_kinase FAT UME FATC Mad3_BUB1_I TPR_1
Other DBs
NCBI-GeneID: 100359062
NCBI-ProteinID: XP_008264498
Ensembl: ENSOCUG00000001874
LinkDB
Position
14
AA seq 2637 aa
MGEHGLELASMIPALRELGSATPEEYNTVVQKPRQILCQFIDRILTDVNVVAVELIKKTD
SQPTSVMLLDFIQHIMKSSPLMFVNVNGSHGQNEAKGNCIEFSNWIITRLLRIAATPSCH
MLHKKICEVICSLLFLFKSKSPAIFGVLTKELLDLFEDLICLHRKHATGHVVEWPVVVSH
FLSQLDEHMGYLQPAPLQFMSMQNLEFIEATLLMVLIRIVAIVFFRRQELLLWHIGCVLL
ECGSPKIKSLAITLLTELFELGGLPAQPASTFFSSFLELLKHLVEMDADQLKLYEKPLSK
LIKTLFPFDAEAYRNIEPVYLNMLLEKLCVMFEDGVLMRLKSDLLKAALCHLLQYFLKFV
PAGYETALQVRKVYVRNICRALVDVLGVQVDAGYLLGPLYAALKMETMEILEEIPCQTPQ
ESLSNDSDGISPKRRRLSSSLNSSKRTSKVAEEIKHVDMNKKSILWSALKQKAEFLQISL
EYNNLKNPVIETLEGITVVLQLTALCTVHCSQQNMDCQNFTDCQHKCKKKPSVVITWMSL
DFFTKVLKSCRSLLESVQKPDLEAVIDNVVKIYDALVYMQVKSPFEDHILEDLCGMLSLP
WIYPHSDDGSLKLTTFATNLLALSERISDSYSPQAQSRCVFLLTLFPRRIFLEWRTAVHN
WALQSCHEVIRASCISGFFILLQQQNSCNRVPKILIDKVKDDSDIVKREFASVLGQLVCS
LHGMFHLTSSLTEPFSEHGHMDLFCKNLKATSPHECSSSQLKASVCKPFLFLLKKKIPSP
VKLAFIDNLQHLCKHLDFKEDETEVKAVLGTLLNLMEDPDKDVRVAFSGNIKYILECLNS
EDGFIKELFVLRMKEAYTHAQISRNNELKDTLILTTGDIGRAAKGDLVPFALLHLLHCLL
SKSSSVSGAAYTEIRALVAAKSVKLQNFFSQYKKPICQFLVESLHSSQMTALPNTPCQNV
EMRKQDVAHQREMALNTLSEVANVFDFPDLNRFLTRTLQVLLPDLAAKASPAASAIIRTL
GKQLNVNRREILINNFKYIFSHLVCSCSKDELERALHYLKNETEIELGSLLRQDFQGLHN
ELLLRIGEHYQQVFNGLSILASFASSDDPYQGPRDITSPELMADYLQPKLLGILAFFNMQ
LLSSSVGIEDKKMALNSLMSLMKLMGPKHVSSVRVKMMTTLRTGLRFKDDFPELCCRAWD
CFVHCLDHAYLGPLLSHVIVALLPLIHIQPKETAAIFHYLIIENRDAVQDFLHEIYFLPD
HPELKKIKAVLQEYRKETSESTDLQTTLQLSMKAVQHENVDVRIHALTSLKETLYKNQEK
LIKYATDSETVEPVISQLVTVLLKGCQDANSQARLLCGECLGELGAIDPGRLDFSTTETQ
GKDFTFVTNVEDPNFAYGLLMELTRAYLAYADNSRAQDSAAYAIQELLAIYDCREMQTDG
PGHQLWRRFPEHVREILEPHLNTRYKSSQKSTDWSGVKKPIYLSKLGNNFAEWSASWAGY
LITKVRDDLASKIFTCCSIMMKHDFKVTIYLLPHILVYVLLGCNEEDQQEVYAEIMAVLK
HDDQQTISTQDSASDLCQLSTQTVFSMLDHLAQWARHKFQVMNADKCSQGKSDSDNVESM
DYRSVTRFLDLIPQDTLAVASFRSKAYTRAVMHFESFITEKKQNIQEHLGFLQKLYAAMD
EPDGVAGVSAIRKAEPSLKEQILEHESLGLLRDATACYDRAIQLEPDQIVHYHGVVKSML
GLGQLSTVITQVNGVHANRSEWTDELNTYRVEAAWKLSQWDLVENYLAEDGKSTSWSVRL
GQLLLSAKKKDITTFYDTLKLVRAEQIVPLSAASFERGSYQRGYEFIVRLHMLCELEHST
KPLFHQSPEDSSQEDSLNWVARLEMTQNSYRAKEPILALRRALLSLNKRPDYDEMVGECW
LQSARVARKAGHHQTAYNALLNAGESRLAELYVERAKWLWSKGDVHQALIVLQKGVELCF
PENKTPAESKDVLIHGRATLLVGRFMEETANFESNAIMKKYKDVTMILPEWEDAHFYLAK
YYDKLMPMVTDNKMEKQGDLIRYIVLHFGKSLQYGNQFIYQSMPRMLTLWLDYGAKAYEW
EKAGRSDRVQMRNDLSKINSVITEHTDYLAPYQFLTAFSQLISRICHSHDEVFVVLMEII
AKVFLAYPQQAMWMMTAVSKSSYPMRVNRCKEILNKAILMKKSLEKFVGDATRLTDKLLE
LCNKPVDGNNSTLSMSTHFKMIKKLVQEATFSEILIPLQSVMIPTLPSVLGAHANHEPFP
GHWAYISGFDDMVEVLPSLQKPKKISLKGSDGKFYIMMCKPKDDLRKDCRLMEFNSLINK
CLRKDAESRRRELHIRTYAVIPLNDECGIIEWVNNTAGLRPILTKLYKERGMYMTGKELR
QCMLPKAAALSEKLKIFQEFLLPRHPPVFHEWFLRTFPDPTSWYSSRSAYCRSTAVMSMV
GYILGLGDRHGENILFDSLTGECVHVDFNCLFNKGETFEVPEIVPFRLTHNMVYGMGPMG
TEGLFRRACEVTLRLMRDQREPLMSVLKTFLHDPLVEWSKPVKGHSKASLNETGEVLNEK
AKTHVLDIEQRLQGVIKTRNRVTGLPLSIEGHVHYLIQEATDANLLCQMYLGWTPYM
NT seq 7914 nt   +upstreamnt  +downstreamnt
atgggcgagcatggcctggaactggcctccatgatccccgccctgcgggagctgggcagt
gccactccagaagaatataatacagttgtacagaagccaagacaaattctatgtcagttc
attgacagaatacttacagatgtaaatgttgttgctgtggaacttataaagaaaactgac
tctcagccaacctctgtgatgttacttgattttatccagcatatcatgaaatcttcccca
cttatgtttgtaaatgtgaatggaagccacggacaaaatgaagccaaaggcaactgtata
gaattcagtaattggatcataacaagacttctgcggattgcagcaactccatcctgtcac
atgttgcacaagaaaatctgtgaagtcatctgctcattattatttctttttaaaagcaag
agtcctgctatttttggagtgctcacaaaggaattattggatctttttgaagatttgatt
tgcctccacagaaaacacgcaacgggacatgttgtggaatggccagtggttgttagccac
tttttaagtcaattagatgaacacatgggttatttacaaccagctcctttgcagttcatg
agcatgcagaatctagaatttattgaagccactttattaatggttcttattcgtattgtc
gcaattgtgttttttagaaggcaagagctcttactttggcatataggttgtgttctgcta
gagtgtggtagtccaaaaattaaatctttagcaatcacccttttaactgaactctttgag
cttggaggactaccagcacaaccagccagcactttttttagctcctttttggagttatta
aaacatcttgtagaaatggatgctgaccaattaaaactctatgaaaagccactgtcaaag
ctgataaagacattgttcccctttgatgcagaagcctacagaaatattgaacctgtctat
ttaaatatgctgctggaaaaactctgtgtcatgtttgaagatggtgtgcttatgcggctt
aagtctgatttgctaaaagcagctttgtgccatttactgcagtatttccttaaatttgtg
ccagctggatatgaaactgctttacaagtcagaaaggtctatgtaagaaatatttgtaga
gctcttgtggatgtgcttggagttcaggtagatgcagggtacttgttgggaccactgtat
gcagccttgaagatggaaactatggaaatccttgaggagattccatgtcaaaccccacag
gaaagcctcagcaacgatagtgatggaatatcacccaaaaggcgtcgactcagctcatct
ctaaactcttccaaaagaacatccaaagtggctgaggaaattaaacatgtggatatgaac
aaaaagagcattttgtggagtgcactgaaacagaaagctgaattccttcagatttccctc
gaatataataatctaaagaatcctgttattgagactttagaaggaatcactgttgtctta
caactgacagctctgtgtactgttcactgttctcagcaaaacatggactgccagaatttc
acagactgtcaacacaaatgtaagaagaaaccttctgtagtgataacttggatgtctttg
gattttttcacaaaagtgcttaagagctgtaggagtttattagaatctgttcagaaacct
gacctagaggcagtcattgataacgtggtgaaaatttatgatgctttggtttatatgcaa
gtaaaaagtccatttgaagatcatatcctggaagatttgtgtggaatgctttcacttccg
tggatttatcctcattctgatgatggctctttgaagttgaccacatttgccactaatctt
ctagcattaagtgagaggatttcagatagctactcaccacaggcgcagtcacgatgtgtg
tttcttctaactctgtttccaagaagaatattccttgaatggagaacagcagttcacaac
tgggccctgcagagctgccatgaagtaattcgggctagttgtattagtggattttttatc
ttattacagcagcagaattcttgcaacagagttcccaagatccttatagataaagtcaaa
gatgattctgacattgtcaagagagaatttgcctctgtacttggtcagcttgtctgtagc
cttcatggcatgtttcatttgacaagttctttaacagaaccgttctctgaacatggacat
atggatctgttctgtaagaacctgaaagccacttctccacacgaatgttcatcttctcaa
ctaaaagcttctgtttgcaagccattccttttcctactgaaaaaaaaaatacctagccca
gtaaaacttgctttcatagataatctacaacatctttgtaagcaccttgattttaaagaa
gatgaaacagaagtaaaagcagttcttggaactttattaaatttaatggaagatccagac
aaggatgtcagagtggcttttagtggaaatatcaagtatatattggaatgcttgaactct
gaagatggatttataaaagagctttttgtcttaagaatgaaggaagcatacacacatgct
cagatatcaagaaataatgagttgaaggatactttgattcttacaacaggggatattgga
agggccgcaaaaggagatttggtaccttttgcactcttgcacttgttgcactgtttatta
tccaagtcatcatccgtctctggagcagcgtacacggaaattagagctctggttgcagcc
aaaagtgttaaattgcaaaactttttcagccagtataagaaacccatctgtcagtttttg
gtggaatccctccactctagtcagatgacagcactgcctaatactccatgccaaaatgtc
gagatgaggaaacaagatgtagctcaccagagagaaatggctttaaatactttatctgaa
gttgccaatgtttttgactttcctgatcttaatcgtttccttactaggacattacaagtt
ttgttacctgaccttgctgccaaagcaagccctgcggcttctgctattattcgaactctt
ggcaaacaattaaatgtcaatcgtagagaaattttaataaataacttcaaatacattttt
tctcatttggtctgttcctgttccaaagatgaattagaacgtgcccttcattatctgaag
aatgaaacagaaattgaactggggagcctgctgagacaggatttccaaggattgcataat
gaattactgctgcgcattggagagcactatcaacaggtcttcaacggtttgtcaatactg
gcctcatttgcatctagtgatgatccataccagggaccaagagatatcacctctcctgag
cttatggctgattatttgcaacccaagttgttgggcattttggccttttttaatatgcaa
ttattgagctccagtgttggcattgaagataagaaaatggccttgaacagcttgatgtct
ttgatgaagttgatgggacccaaacacgttagttctgtgagggtgaagatgatgaccact
ctgagaactggccttcggttcaaggatgattttcctgagttgtgttgcagagcttgggac
tgctttgttcattgcctggatcatgcttatctcggcccgcttctgagtcacgtaatagta
gctttgttacctctcatacacatccagcctaaggaaactgcagctatctttcactacctt
ataattgagaacagggatgctgtccaggattttcttcatgaaatatattttctacctgat
catccagaattaaaaaagataaaagcagttctccaggaatatagaaaggagacctctgaa
agtactgatcttcaaacaacgcttcagctatccatgaaagcagttcaacatgaaaatgta
gatgttcgtattcatgctcttactagcttaaaggaaaccttatataaaaaccaggaaaaa
ctgataaaatatgcaacagatagtgaaacagtagaacctgttatctcgcagttggtgaca
gtgcttttgaaaggttgtcaagatgcaaactctcaagctcggttactctgtggtgaatgt
ttaggggaattgggagcaatagatccaggacggttagatttctcaacaactgaaactcaa
ggaaaagattttacatttgtgactaatgtagaagacccaaactttgcttatggtttattg
atggagctaacaagagcttaccttgcatatgccgataacagccgagctcaggattcagct
gcttatgccattcaggagctgcttgctatttatgactgtagagaaatgcagactgatggc
ccaggtcaccagttatggagaagatttcctgagcatgttcgggaaatactggaacctcat
ctaaatactagatacaagagttctcaaaagtcaacagattggtctggagtaaagaaacca
atttacttaagcaaattaggtaataactttgcagaatggtccgcatcttgggcaggttat
cttataacaaaggttcgggatgaccttgctagtaaaattttcacctgctgtagcataatg
atgaagcatgatttcaaggtgaccatctatcttcttccacatattctagtgtatgtcttg
ttgggttgtaatgaagaagatcaacaggaggtttatgcagaaattatggcagttctaaag
catgacgatcagcagaccatcagtacccaagacagtgcatctgatctgtgtcagctcagt
acacagactgtgttctccatgcttgatcatcttgcacagtgggcaaggcacaaatttcaa
gtaatgaatgctgacaaatgttcacagggcaaatcagacagtgataatgtagagtcaatg
gactatcgaagtgttactcgctttctagacctcatacctcaagatactctggcagtagca
tcgtttcgctccaaagcatacacaagagccgttatgcactttgaatcgtttattacagaa
aagaagcaaaatattcaagagcaccttggatttttacagaaattgtatgctgctatggat
gagccagatggagtggctggagtcagcgcaattcgaaaggcagagccatctctaaaagag
caaatccttgaacatgaaagccttggcttgctgagggatgctactgcttgctatgacagg
gctattcagctagaaccagaccagatcgttcattatcatggtgtagtgaagtctatgtta
ggtcttggtcagctgtctactgtaatcactcaggtgaatggagtgcatgctaacaggtct
gaatggacagatgaattaaacacatacagagtggaagcagcttggaaattgtcacagtgg
gatttggtggaaaactatttggcagaagatgggaaatctacatcgtggagtgtcagactg
ggacaattgttattatcagccaaaaaaaaagatatcacaactttttatgacacattgaaa
ctggtgagagcagaacaaattgtacctctttccgctgcaagctttgaaagaggctcttac
caacgaggatatgagtttattgtgagattgcacatgttgtgtgaattggagcatagcacc
aaaccactttttcaccagtctccagaagacagttctcaagaggattctctaaactgggta
gctcgactagaaatgactcagaattcttacagagccaaggagcctattctggctctccgg
agggctttattaagtctcaacaaaagacctgactacgatgaaatggttggagaatgctgg
ctacagagtgccagagtggccagaaaggctggtcaccaccagacagcctacaatgctctc
cttaacgcaggagaatcacggcttgctgaactgtatgtggagagggcaaagtggctgtgg
tccaagggtgatgttcaccaggcacttattgttcttcagaagggtgttgaactatgtttt
cctgaaaataaaaccccagctgagagtaaggacgtattgattcatggtcgagctacgcta
ctagtgggccgatttatggaagaaacagctaattttgaaagcaatgcaattatgaaaaaa
tataaggatgtgaccatgatactgccagagtgggaggatgcgcatttctaccttgccaag
tactatgacaaattgatgcctatggtcacagacaacaaaatggaaaagcagggtgatctt
atccggtatatagtccttcattttggaaaatctctacagtatggaaatcaattcatatat
cagtcaatgccacgaatgttgacattatggcttgattatggtgcgaaggcatatgaatgg
gaaaaagctggccgctctgatcgtgtacaaatgagaaatgatttaagtaaaataaacagc
gttatcacagaacacacagattatttagctccctatcaatttttgactgctttttcacaa
ttgatctctcggatttgccattctcatgatgaagtttttgttgtcttaatggaaataata
gccaaggtatttctggcctaccctcaacaagcaatgtggatgatgactgctgtgtcaaag
tcttcgtatcctatgcgtgtgaacagatgcaaagaaatcctaaataaggctatcctaatg
aaaaagtccttagaaaagtttgttggagatgcaactcgcctcacagataagcttctagaa
ttgtgcaataaaccggttgatggaaataattccacattaagcatgagcacacattttaaa
atgattaaaaagctggtacaagaagcaacatttagtgaaatcctcattcctttgcaatca
gtcatgatacctactcttccatccgttttgggtgcccatgctaaccacgagccatttcct
gggcactgggcctatatttcaggctttgatgatatggtggaagttcttccttctcttcag
aaaccaaagaagatctctttaaaagggtcagatggaaaattctacataatgatgtgtaaa
ccgaaagatgacctcagaaaggactgtagactaatggaattcaattccttgattaataag
tgcttaagaaaagatgcagaatctcgtagaagagaacttcatatccgaacctatgccgtt
attccactgaatgatgaatgtggaattattgaatgggtgaacaacactgctggcttgaga
cctattctgaccaaattatataaggaaaggggaatgtatatgacaggaaaggaacttcgc
cagtgtatgctaccaaaggcagcagctttgtctgaaaaactcaaaatattccaagaattt
ctactacctagacatcctcctgttttccatgagtggtttctgagaacattccctgatccg
acatcatggtacagtagcagatcagcatactgccgttctactgccgtaatgtcaatggtt
ggttatatcctgggacttggagaccgtcatggtgaaaacattctctttgattctttgacg
ggtgaatgtgtacatgtggatttcaactgtctttttaataagggagaaacttttgaagtt
cctgaaattgtgccatttcgccttactcataacatggtttatggaatgggtcctatgggt
acagagggtctttttcgaagagcatgtgaagttacactaaggctgatgcgagaccagaga
gaacctttaatgagtgtcttgaagacttttctgcatgatcctcttgtggagtggagtaaa
ccagtgaaagggcattccaaagcatcactgaacgaaactggggaagtcctcaacgaaaag
gctaagactcatgttcttgacatcgagcagcgattacagggtgtaatcaagacccgaaat
agagtgacagggctgccattatctattgaaggacatgtgcattaccttatccaagaggct
actgatgcgaacttactctgccaaatgtaccttggttggaccccatatatgtga

DBGET integrated database retrieval system