KEGG   Olea europaea var. sylvestris (wild olive): 111381728
Entry
111381728         CDS       T05244                                 

Definition
(RefSeq) cytochrome P450 704B1-like
  KO
K20495  long-chain fatty acid omega-monooxygenase [EC:1.14.14.80]
Organism
oeu  Olea europaea var. sylvestris (wild olive)
Pathway
oeu00071  Fatty acid degradation
oeu00073  Cutin, suberine and wax biosynthesis
oeu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:oeu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    111381728
   00073 Cutin, suberine and wax biosynthesis
    111381728
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:oeu00199]
    111381728
Enzymes [BR:oeu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.80  long-chain fatty acid omega-monooxygenase
     111381728
Cytochrome P450 [BR:oeu00199]
 Cytochrome P450, plant type
  CYP704 family
   111381728
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 111381728
NCBI-ProteinID: XP_022861306
LinkDB
Position
Unknown
AA seq 517 aa
MGIMVLAFCMFFSWIFLHRLKQRNAKGPKTWPFVGAAIEQLMNYDRMHDWLVEYFAQSRT
VVVPMPFTTYTYIADPANVEHVLKTNFNNYPKGEVYHSYMEVLLGDGIFNADGEHWRKQR
KTASFEFASKNLRDFSTVVFREYSLKLSEILSQASYSNQQVDMQELLMRMTLDSICKVGF
GVEIGTLAPNLPDNLFAKAFDTANIIVTLRFIDPLWRIKKFFNLGSEAILDQSIKTVDDF
TYSVIRRRKEEIDDARGYNKDDKIKHDILSRFIELSKDPENNMTDKSLRDVVLNFVIAGR
DTTATTLAWAIYMIISHKDVAHKLYSELKSFEEDRAKEENISFDMHHTEDQESFNQRISQ
FAGLLNYDSLGKLYYLHAVVTETLRLYPAVPQDPKGILENDVLPDGTKVKAGGMVTYVPY
SMGRMEYNWGPDAALFKPERWLKDGIFQNASPFKFTAFQAGPRICLGKDSAYLQMKMALA
ILSRFYKFQLFPGHPVKYRMMTVLSMEKGMKLIVSKR
NT seq 1554 nt   +upstreamnt  +downstreamnt
atgggaataatggtgctggctttctgcatgttcttttcatggatcttccttcacagattg
aagcagaggaatgccaaaggtcccaaaacatggccatttgtgggggctgccatagaacag
ctgatgaattacgacagaatgcacgactggcttgtcgaatatttcgcccagtcgagaacc
gtagttgtgccaatgcctttcacaacttatacatatattgcagatccagccaatgtggag
catgtcctgaaaacaaactttaacaattacccaaagggtgaagtatatcattcatacatg
gaagttcttcttggagatggtattttcaatgcagatggtgagcattggaggaaacagagg
aagactgctagtttcgagtttgcgtccaagaacttgagggatttcagcactgtggtattc
agagagtatagcctcaaactctctgaaattctgagccaagcatcttacagcaatcagcaa
gtagatatgcaggaacttctaatgagaatgactctagactcaatatgtaaggtaggattt
ggtgtagaaataggaacattggctcctaatttaccagacaatctctttgccaaggccttt
gatactgcaaatattatagtaactcttagattcattgaccctttgtggagaatcaagaaa
ttctttaatctgggatcagaagctatccttgatcagagtattaaaactgttgatgatttc
acgtactctgtcatccgaaggagaaaagaagaaatagacgacgccagagggtataataaa
gatgataagatcaagcatgacatattgtcgagattcattgagctaagcaaagatcctgag
aacaatatgaccgacaaaagcttaagagatgttgtcctaaactttgtaattgctgggcgt
gataccactgctacgacacttgcgtgggctatctacatgataatatcccacaaagatgta
gcacacaagctttattcagaactaaaaagtttcgaagaagatcgcgcaaaagaggagaac
atctcattcgatatgcatcatacagaggatcaagaatcattcaatcagagaatttcgcaa
tttgcaggacttctaaactacgattccttagggaaactgtattatttacatgctgtggtt
acagaaacacttcgattgtacccagcagttcctcaggatcccaaaggcatattagaaaat
gatgttttaccggatggaaccaaagtaaaggctggaggcatggtgacatacgttccatac
tcgatgggaagaatggagtacaattggggtccagatgcagctttgttcaagcccgagaga
tggctcaaagacgggatcttccaaaatgcatctccatttaaatttactgcatttcaggct
ggaccaaggatatgccttggaaaggattcagcatatctccagatgaagatggcactggca
attttgtctagattctataaattccaattgtttccaggacatcctgtgaagtacaggatg
atgacagttctgtcaatggaaaagggaatgaagcttatagtctccaaacgttag

DBGET integrated database retrieval system